DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UK114 and RIDA

DIOPT Version :9

Sequence 1:NP_001260465.1 Gene:UK114 / 34897 FlyBaseID:FBgn0086691 Length:138 Species:Drosophila melanogaster
Sequence 2:NP_005827.1 Gene:RIDA / 10247 HGNCID:16897 Length:137 Species:Homo sapiens


Alignment Length:137 Identity:64/137 - (46%)
Similarity:98/137 - (71%) Gaps:0/137 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSTIVRKLISTANAAKPVAPYNQAVVADRTVYVSGCLGLDKDTMKLVPGGPTEQAQKALENLEAV 65
            ||:::|::||||.|...:.||:|||:.|||:|:||.:|:|..:.:||.||..|:|::||:|:..:
Human     1 MSSLIRRVISTAKAPGAIGPYSQAVLVDRTIYISGQIGMDPSSGQLVSGGVAEEAKQALKNMGEI 65

  Fly    66 LKAADSGVDKVIKNTVFLKDLNDFGAVNEVYKRVFNKDFPARSCFQVAKLPMDALVEIECIALTG 130
            ||||......|:|.||.|.|:|||..|||:||:.|..:||||:.:|||.||..:.:|||.:|:.|
Human    66 LKAAGCDFTNVVKTTVLLADINDFNTVNEIYKQYFKSNFPARAAYQVAALPKGSRIEIEAVAIQG 130

  Fly   131 SVETKTV 137
            .:.|.::
Human   131 PLTTASL 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UK114NP_001260465.1 YjgF_YER057c_UK114_family 6..127 CDD:299145 59/120 (49%)
RIDANP_005827.1 TIGR00004 6..129 CDD:129116 60/122 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148115
Domainoid 1 1.000 122 1.000 Domainoid score I5670
eggNOG 1 0.900 - - E1_COG0251
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4261
Inparanoid 1 1.050 139 1.000 Inparanoid score I4519
Isobase 1 0.950 - 0 Normalized mean entropy S674
OMA 1 1.010 - - QHG60620
OrthoDB 1 1.010 - - D1435276at2759
OrthoFinder 1 1.000 - - FOG0001697
OrthoInspector 1 1.000 - - oto88954
orthoMCL 1 0.900 - - OOG6_100612
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R724
SonicParanoid 1 1.000 - - X1603
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.650

Return to query results.
Submit another query.