DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cul3 and AT1G59800

DIOPT Version :9

Sequence 1:NP_723909.2 Gene:Cul3 / 34896 FlyBaseID:FBgn0261268 Length:934 Species:Drosophila melanogaster
Sequence 2:NP_176189.1 Gene:AT1G59800 / 842273 AraportID:AT1G59800 Length:255 Species:Arabidopsis thaliana


Alignment Length:240 Identity:59/240 - (24%)
Similarity:118/240 - (49%) Gaps:9/240 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   190 ETIWASLKNAIQEIQK--KNNSGLSFEQ-----LYRNAYNMVLHKHGNRLYYGLREVVSEHLEHK 247
            |..|::::....::.:  :..|..:|.|     ::...|.:..:|:..:||...||::..:....
plant    10 EVEWSNIQQGFTKLIRMIEGESEPAFNQEIMMMMHTATYRICAYKNPQQLYDKYRELIENYAIQT 74

  Fly   248 VRADVLEALHSNFLPKLNQAWTDHQTSMVMIRDILMYMDRVYVQQREVDNVYNLGLILFRDQVVR 312
            |...:.|......|.:|.:.|..|:..:.:....|:|:|..::.::.:.::..:||..|||||  
plant    75 VLPSLREKHDECMLRELAKRWNAHKLLVRLFSRRLVYLDDSFLSKKGLPSLREVGLNCFRDQV-- 137

  Fly   313 YSEIQKALREKLLGMVMEERHGEAINHLAIKNACSMLITLGINSRTVYEEDFEKPFLAQSAAFYK 377
            |.|:|....|.:|.::.:||.||.|:...::|...:.:..|:.:...||||||:..|..:|::|.
plant   138 YREMQSMAAEAILALIHKEREGEQIDRELVRNVIDVFVENGMGTLKKYEEDFERLMLQDTASYYS 202

  Fly   378 FESQNFLAENNAGVYIKKVEARITEESSRAALYLDKDTEPRIVRV 422
            .::..::.|.:...|..|.:..:..|..|...||...|||::..|
plant   203 SKASRWIQEESCLDYTLKPQQCLQRERERVTHYLHPTTEPKLFEV 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cul3NP_723909.2 Cullin 196..831 CDD:279260 57/234 (24%)
CULLIN 582..724 CDD:214545
Cullin_Nedd8 866..926 CDD:287520
AT1G59800NP_176189.1 Cullin 41..>255 CDD:279260 54/209 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5647
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1040292at2759
OrthoFinder 1 1.000 - - FOG0000491
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.