DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cul3 and AT4G12100

DIOPT Version :9

Sequence 1:NP_723909.2 Gene:Cul3 / 34896 FlyBaseID:FBgn0261268 Length:934 Species:Drosophila melanogaster
Sequence 2:NP_192947.1 Gene:AT4G12100 / 826818 AraportID:AT4G12100 Length:434 Species:Arabidopsis thaliana


Alignment Length:405 Identity:92/405 - (22%)
Similarity:166/405 - (40%) Gaps:88/405 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   188 YVETIWASLKNAIQEI-----QKKNNSGLSFEQLYRN--------------AYNMVLHKHGNRLY 233
            |:...|..||.||:.|     .||....|.|..::|.              .:|:|.|:      
plant    76 YLAKAWDLLKPAIKIILDDDEYKKPGDVLCFTTIFRAVKRACLGDPRQSELVFNLVKHE------ 134

  Fly   234 YGLREVVSEHLEHKVRADVLEALHSN---------FLPKLNQAWTDHQTSMVMIRDILMYMDRVY 289
                  ...|:     |:::::|..|         |||.:...|.|.:..|.::.|:.||     
plant   135 ------CEPHI-----AELIQSLEKNCSGSDDPSVFLPHVYNRWLDFKRKMSLVSDVAMY----- 183

  Fly   290 VQQREVDNVYNLGLILFRDQVVRYSEIQKALREKLLGMVMEERHGEAINHLA--IKNACSMLITL 352
             |......::::|..||..|:....::|..:...:|.::.:||.|:|.|:.:  :||...| ..:
plant   184 -QTLNGLTLWDVGQKLFHKQLSMAPQLQDQVITGILRLITDERLGKAANNTSDLLKNLMDM-FRM 246

  Fly   353 GINSRTVYEEDFEKPFLAQSAAFYKFESQNFLAENNAGVYIKKVEARITEESSRAALYLDK---- 413
            ......||::    |||..::.||..|::..|..::...|:|.||.....|..:.    ||    
plant   247 QWQCTYVYKD----PFLDSTSKFYAEEAEQVLQRSDISHYLKYVERTFLAEEEKC----DKHYFF 303

  Fly   414 --DTEPRIVRVVEEELIKKHMRPIVEMENSGVVYMIKNSKTEDLACTYKLFSRLKEEGLKVIADT 476
              .:..|:::|::.:|::.|...:.|    |.:.::..|..:||...|:|||.:..|  ..|...
plant   304 FSSSRSRLMKVLKSQLLEAHSSFLEE----GFMLLMDESLIDDLRRMYRLFSMVDSE--DYIDRI 362

  Fly   477 MSAYLREQGRMLVKEEENGNTNPITFVQNLLDLKDRFDQFLVHSFANDRIFKNVISSDFEHF-LN 540
            :.||:..:|....:|            .:|.:|....|:.....|..|.:....|...||.| |:
plant   363 LRAYILAKGEGARQE------------GSLQELHTSIDKIWHQCFGQDDLLDKTIRDCFEGFGLH 415

  Fly   541 LNNKSPEYLSLFIDD 555
            :..:..:.|. :|||
plant   416 VPGEFSDQLQ-WIDD 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cul3NP_723909.2 Cullin 196..831 CDD:279260 90/397 (23%)
CULLIN 582..724 CDD:214545
Cullin_Nedd8 866..926 CDD:287520
AT4G12100NP_192947.1 Cullin 82..>412 CDD:279260 84/379 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5647
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1040292at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.