DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cul3 and AT3G46910

DIOPT Version :9

Sequence 1:NP_723909.2 Gene:Cul3 / 34896 FlyBaseID:FBgn0261268 Length:934 Species:Drosophila melanogaster
Sequence 2:NP_190275.1 Gene:AT3G46910 / 823844 AraportID:AT3G46910 Length:247 Species:Arabidopsis thaliana


Alignment Length:233 Identity:50/233 - (21%)
Similarity:101/233 - (43%) Gaps:36/233 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   188 YVETIWASLKNAIQEIQKKNNSGLSFEQLYRNAYN--MVLHKHGNRLYYGLREVVSEHLEHKVRA 250
            |||..|..||.||:.|........:...|: ||.|  ......|..||    :::.|..|..:.|
plant    25 YVEDAWTMLKPAIRAIFLDEPQDFACSGLF-NAVNKSWCEKSSGEALY----KLILEECEIYISA 84

  Fly   251 DVLEALHSN-------FLPKLNQAWTDHQTSMVMIRDILMYMDRVYVQQREV---DNVYNLGLIL 305
             .:::|.|.       ||..|.:.|.|       .|..|.::..:...:.:.   .:|::||..|
plant    85 -AIQSLESQCDTDPSLFLSLLEKCWLD-------FRRKLQFLCSIAGGEGQTVGPHSVWDLGSEL 141

  Fly   306 FRDQVVRYSEIQKALREKLLGMVMEERHGEAINHLAIKNACSMLITLGIN----------SRTVY 360
            ....:....:::..|...:|.::.::|...:::...:||....::::.:.          .:::|
plant   142 SPKHLFSAQKVRDKLLSIILQLIRDQRSFMSVDMTQLKNTTRPVMSVHMTQLNNLRGLFYGQSLY 206

  Fly   361 EED-FEKPFLAQSAAFYKFESQNFLAENNAGVYIKKVE 397
            :.. |:|||:..:..||..|:..|..:::..:|:|:||
plant   207 KSPFFKKPFIDCAVEFYSAEAMQFKEQSDIPLYLKRVE 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cul3NP_723909.2 Cullin 196..831 CDD:279260 46/225 (20%)
CULLIN 582..724 CDD:214545
Cullin_Nedd8 866..926 CDD:287520
AT3G46910NP_190275.1 Cullin 33..>244 CDD:279260 44/223 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5647
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1040292at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.