DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cul3 and mr

DIOPT Version :9

Sequence 1:NP_723909.2 Gene:Cul3 / 34896 FlyBaseID:FBgn0261268 Length:934 Species:Drosophila melanogaster
Sequence 2:NP_611862.1 Gene:mr / 45906 FlyBaseID:FBgn0002791 Length:802 Species:Drosophila melanogaster


Alignment Length:621 Identity:104/621 - (16%)
Similarity:203/621 - (32%) Gaps:184/621 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   200 IQEIQKKNNSGLSFEQLYRNAYNMVLHKHGNRLYYGLREVVSEHLEHKVRADVLEALHSNFLPKL 264
            :.::..|.|..| ||.      |::....|:.|...::..:.||:     :|....:......|.
  Fly   218 LTDMVNKTNMKL-FEM------NLIDRLTGSALTALIKLKIKEHI-----SDTCMGIFDRSHLKQ 270

  Fly   265 NQAWTDHQTSMVMIRDILM-YMDRVYVQQREVDNVYNLGLILFRDQVVRYSEIQKALREKLLGMV 328
            .:.|         :.|::| ::..::.:.:..|::.:          :...|..|:.:.||...:
  Fly   271 LETW---------LSDVIMSWLTNIFTEWKSKDSISD----------IEVPESVKSFKVKLTYFM 316

  Fly   329 MEERHGEAINHLAIKNACSMLITLGINSRTVYEEDFEKPFLAQSAAFYKFESQNFLAENNAGVYI 393
            .                                |.|.:..:.|..:.......:..|.::..:.:
  Fly   317 Y--------------------------------ETFAQSVIGQFFSIIIDYPDSIPAIDDLKICM 349

  Fly   394 KKVEARI-TEESSRAALYLDKDTEPRIVR--VVEEELIKKH---MRPIVEMENSGVVYMIKNSKT 452
            :|::.|: ..||.|.:|      |.||:.  |...:::..:   ::.|..::::||:        
  Fly   350 EKIDMRVYLTESLRNSL------EARILHPGVNTMDILTGYVAAIKAIRHLDSTGVI-------- 400

  Fly   453 EDLACTYKLFSRLKEEGLKVIADTMSAYLREQG----RMLVKEEENGNTNPITFVQNLLDLKDRF 513
                             |:::...:..|||::.    |::....|.|.|:               
  Fly   401 -----------------LEMVTAPIKDYLRKRNDTVRRVVTGLTEEGPTD--------------- 433

  Fly   514 DQFLVHSFANDRIFKNVISSDFEHFLNLNNKSPEYLSLFIDDKL---KKGGKGMSEQEIESILDK 575
               |....|.....|....|..:.|.|..|..|:...  ||..:   ....|..|...|..::| 
  Fly   434 ---LSEELAKGETIKECKDSGTDEFSNWENWQPDPFG--IDASIMQYNSSRKMRSADIISMVVD- 492

  Fly   576 TMVLFRFLLEKDVFERYYKTHLAKRLLLNKSVSDDFEKNMISKLKTECGCQFTSKLEGMFKDMSV 640
                  ....|::|...|:..:|.|||.....:.:.|...:..||...|.......|.|.||::.
  Fly   493 ------IYGSKELFMTEYRNLMADRLLAQLDFNSEKEIRNLELLKIRFGESLLHSCEVMLKDVTD 551

  Fly   641 SNTIMDEFKNFVNNNNLSLGG-------VELTVRILTTGFWPTQTATPNCNIPAAPREAFDIFKN 698
            |..|         |.::...|       .:::..|::..|||:.    |......|.|..:.||.
  Fly   552 SKRI---------NAHIHSDGDRTENQLFDISSLIVSAQFWPSF----NKESLQLPEEIENEFKK 603

  Fly   699 F---YLNKHSGRQLTLQPQMGTAYINAVFYGRKAVESEKDKDAPSSSSSGCGVPTTTRKHILQVS 760
            :   |......|.|..:...|...|. :..|.:.:|                         :.||
  Fly   604 YTKAYEAYKGNRTLNWRTVTGRVNIE-IEIGDRTME-------------------------MVVS 642

  Fly   761 TYQMCVLLLFNNRDVLTYDDIHQETDIPERELVRAL 796
            .....::..|..::..|.:|:...|.:|...|.|.|
  Fly   643 PILAVIIYHFQTKNEWTIEDLSSITKVPASALRRRL 678

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cul3NP_723909.2 Cullin 196..831 CDD:279260 104/621 (17%)
CULLIN 582..724 CDD:214545 33/151 (22%)
Cullin_Nedd8 866..926 CDD:287520
mrNP_611862.1 CULLIN 494..632 CDD:214545 33/151 (22%)
APC2 741..800 CDD:198081
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467935
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.