DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cul3 and Cacul1

DIOPT Version :9

Sequence 1:NP_723909.2 Gene:Cul3 / 34896 FlyBaseID:FBgn0261268 Length:934 Species:Drosophila melanogaster
Sequence 2:XP_006231740.1 Gene:Cacul1 / 365493 RGDID:1308127 Length:377 Species:Rattus norvegicus


Alignment Length:294 Identity:58/294 - (19%)
Similarity:110/294 - (37%) Gaps:84/294 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 PLTPTPLSMP-------VPAPAAPAVVKTETSATTSGPSTSASASAESTEKRFKEIARKYPLWLP 173
            |:...|||.|       ....||.||.|     ....|:.|::.:..::..:|            
  Rat    83 PMGSPPLSEPNGVIMMLKSCDAAAAVAK-----AAPAPTPSSTININTSTSKF------------ 130

  Fly   174 EYKRRAFNASMDEKYVETIWASLKNAIQEIQKKNNSG---LSFEQLYRNAYNMVLHKHGNRLYYG 235
                 ..|....|.|..|.|..|..||.::..::...   :|:||:|...|..|..:|..::|..
  Rat   131 -----LMNVITIEDYKSTYWPKLDGAIDQLLTQSPGDYIPISYEQIYSCVYKCVCQQHSEQMYSD 190

  Fly   236 LREVVSEHLEHKVRADVLEALHSNFLPKLNQAWTDHQTSMVMIRDILMYMDRVYVQQREVDNVYN 300
            |.:.::.||| :|..::..:....::.:.|.|...:..::..|..:.:||::.|::         
  Rat   191 LIKKITSHLE-RVSKELQASPPDLYIERFNIALGQYMGALQSIVPLFIYMNKFYIE--------- 245

  Fly   301 LGLILFRDQVVRYSEIQKALREKLLGMVMEERHGEAINHLAIKNACSMLITLGINSRTVYEEDFE 365
                         :::.:.|::.|:.:..|        |:|.|:..|::                
  Rat   246 -------------TKLNRDLKDDLIKLFTE--------HVAEKHIYSLM---------------- 273

  Fly   366 KPFL--AQSAAFYKFESQNFLAENNAGVYIKKVE 397
             |.|  |||..|....|.  :|....|:|..:.|
  Rat   274 -PLLLEAQSTPFQVTPST--MANIVKGLYTLRPE 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cul3NP_723909.2 Cullin 196..831 CDD:279260 40/207 (19%)
CULLIN 582..724 CDD:214545
Cullin_Nedd8 866..926 CDD:287520
Cacul1XP_006231740.1 Cullin 146..>264 CDD:279260 25/148 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5647
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.