DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uxt and UXT

DIOPT Version :9

Sequence 1:NP_001260464.1 Gene:Uxt / 34893 FlyBaseID:FBgn0259982 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_705582.1 Gene:UXT / 8409 HGNCID:12641 Length:169 Species:Homo sapiens


Alignment Length:134 Identity:38/134 - (28%)
Similarity:73/134 - (54%) Gaps:0/134 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 DANKARITQIEEFINEVLKEDLRELEKCIGQYNEEIMEYVQLKNTLQTFDTHLPDGYKTQVNIGS 82
            :|...::.:.|.||::||:.|||::.....:..|::.:|:||:|.::............||::|.
Human    23 EATGEKVLRYETFISDVLQRDLRKVLDHRDKVYEQLAKYLQLRNVIERLQEAKHSELYMQVDLGC 87

  Fly    83 NVFMQARVRKMDSILVDVGKNVFLDMSIPDAERFCDTRVKILTKQSDVLRDESVKKRAQIKMALI 147
            |.|:...|.....|.|.:|...||::::.:|.:|.|.:..:||:.|:.|..:|:..:|.|.|.|.
Human    88 NFFVDTVVPDTSRIYVALGYGFFLELTLAEALKFIDRKSSLLTELSNSLTKDSMNIKAHIHMLLE 152

  Fly   148 AISE 151
            .:.|
Human   153 GLRE 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UxtNP_001260464.1 Prefoldin_alpha 26..154 CDD:238327 37/126 (29%)
UXTNP_705582.1 Prefoldin_alpha 30..159 CDD:238327 37/127 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 56 1.000 Domainoid score I11076
eggNOG 1 0.900 - - E1_KOG3047
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 68 1.000 Inparanoid score I5343
Isobase 1 0.950 - 0 Normalized mean entropy S6280
OMA 1 1.010 - - QHG54805
OrthoDB 1 1.010 - - D1559312at2759
OrthoFinder 1 1.000 - - FOG0005437
OrthoInspector 1 1.000 - - oto90579
orthoMCL 1 0.900 - - OOG6_103935
Panther 1 1.100 - - LDO PTHR13345
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5483
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.820

Return to query results.
Submit another query.