DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uxt and AT1G26660

DIOPT Version :9

Sequence 1:NP_001260464.1 Gene:Uxt / 34893 FlyBaseID:FBgn0259982 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_001185101.1 Gene:AT1G26660 / 839206 AraportID:AT1G26660 Length:177 Species:Arabidopsis thaliana


Alignment Length:143 Identity:36/143 - (25%)
Similarity:68/143 - (47%) Gaps:0/143 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 ANKARITQIEEFINEVLKEDLRELEKCIGQYNEEIMEYVQLKNTLQTFDTHLPDGYKTQVNIGSN 83
            |::.|...:..|:.......|:..:.||..|.|:......|:..|:|.:.:..:..||:||:||.
plant    29 ASRFRFIVVSAFVGFAGTRSLKNKKHCILLYREDSSFSSDLRKNLETLEKNGVNSLKTRVNLGSE 93

  Fly    84 VFMQARVRKMDSILVDVGKNVFLDMSIPDAERFCDTRVKILTKQSDVLRDESVKKRAQIKMALIA 148
            |:|||.|.....|.:|||...:::.:..:|..:...|.:...||.:.......:.:.:||:|...
plant    94 VYMQAEVPDTRHIFMDVGLGFYVEFTRQEALDYIAQREERTQKQLEEYTGVITQIKGRIKLAHYQ 158

  Fly   149 ISERTKLIQQDES 161
            |.:...|.:::.|
plant   159 IQQILNLPEENPS 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UxtNP_001260464.1 Prefoldin_alpha 26..154 CDD:238327 32/127 (25%)
AT1G26660NP_001185101.1 Prefoldin 67..162 CDD:281054 26/94 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 44 1.000 Domainoid score I4703
eggNOG 1 0.900 - - E1_KOG3047
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2592
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1559312at2759
OrthoFinder 1 1.000 - - FOG0005437
OrthoInspector 1 1.000 - - oto3386
orthoMCL 1 0.900 - - OOG6_103935
Panther 1 1.100 - - LDO PTHR13345
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.830

Return to query results.
Submit another query.