DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uxt and uxt

DIOPT Version :9

Sequence 1:NP_001260464.1 Gene:Uxt / 34893 FlyBaseID:FBgn0259982 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_001004671.1 Gene:uxt / 447933 ZFINID:ZDB-GENE-040912-118 Length:155 Species:Danio rerio


Alignment Length:130 Identity:46/130 - (35%)
Similarity:77/130 - (59%) Gaps:2/130 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 RITQIEEFINEVLKEDLRE-LEKCIGQYNEEIMEYVQLKNTLQTFDTHLPDGYKTQVNIGSNVFM 86
            ::.|.|.||:|||:.||:: ||:....| |:|.:|:|||||:|:.........||.|::|.|.::
Zfish    11 KVLQYETFISEVLRRDLQKVLEQRDAVY-EKIAQYLQLKNTIQSIQESGSKELKTDVDLGCNFYV 74

  Fly    87 QARVRKMDSILVDVGKNVFLDMSIPDAERFCDTRVKILTKQSDVLRDESVKKRAQIKMALIAISE 151
            ||.|.....|.|.||...|::.:..:|.:|.:.:...||:.::||..::.|.:|.|:|.|..:.|
Zfish    75 QAHVPDASRIYVAVGYGFFVEFTHAEALKFIEKKTNQLTEYTEVLTKDAAKIKANIRMVLEGLRE 139

  Fly   152  151
            Zfish   140  139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UxtNP_001260464.1 Prefoldin_alpha 26..154 CDD:238327 46/127 (36%)
uxtNP_001004671.1 Prefoldin_alpha 13..142 CDD:238327 46/128 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 67 1.000 Domainoid score I9824
eggNOG 1 0.900 - - E1_KOG3047
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I5220
OMA 1 1.010 - - QHG54805
OrthoDB 1 1.010 - - D1559312at2759
OrthoFinder 1 1.000 - - FOG0005437
OrthoInspector 1 1.000 - - oto40751
orthoMCL 1 0.900 - - OOG6_103935
Panther 1 1.100 - - LDO PTHR13345
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5483
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1413.870

Return to query results.
Submit another query.