DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uxt and F35H10.6

DIOPT Version :9

Sequence 1:NP_001260464.1 Gene:Uxt / 34893 FlyBaseID:FBgn0259982 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_501397.2 Gene:F35H10.6 / 177625 WormBaseID:WBGene00018071 Length:158 Species:Caenorhabditis elegans


Alignment Length:128 Identity:30/128 - (23%)
Similarity:59/128 - (46%) Gaps:0/128 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 ANKARITQIEEFINEVLKEDLRELEKCIGQYNEEIMEYVQLKNTLQTFDTHLPDGYKTQVNIGSN 83
            |.:..:..:|:....|:...:...||...:..::..||.:||.|.|......|...:.:..:|..
 Worm     7 AQERYMKYLEDLSENVIHPKIATEEKEFKKLQKQCEEYAKLKFTCQRLLNEAPKTTEGKTELGQR 71

  Fly    84 VFMQARVRKMDSILVDVGKNVFLDMSIPDAERFCDTRVKILTKQSDVLRDESVKKRAQIKMAL 146
            |||...||....::|.:..:|:::|.:.||.:.||.::..|....:.|:..:.|.:..:.|.|
 Worm    72 VFMNIEVRDTKHVVVKLCDDVYVEMKLQDAIKTCDRKMDSLKNMMEKLQKSTNKLKTDLTMLL 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UxtNP_001260464.1 Prefoldin_alpha 26..154 CDD:238327 29/121 (24%)
F35H10.6NP_501397.2 Prefoldin_alpha 15..141 CDD:238327 29/120 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 49 1.000 Domainoid score I7931
eggNOG 1 0.900 - - E1_KOG3047
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 52 1.000 Inparanoid score I4092
Isobase 1 0.950 - 0 Normalized mean entropy S6280
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005437
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103935
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.710

Return to query results.
Submit another query.