DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dao and SET6

DIOPT Version :9

Sequence 1:NP_001260462.1 Gene:dao / 34891 FlyBaseID:FBgn0028862 Length:882 Species:Drosophila melanogaster
Sequence 2:NP_015160.1 Gene:SET6 / 855938 SGDID:S000006086 Length:373 Species:Saccharomyces cerevisiae


Alignment Length:312 Identity:63/312 - (20%)
Similarity:100/312 - (32%) Gaps:78/312 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   378 YCSRQCRFKHAAIHAVECFGHQIELFESFGEVFGMPRLLQLAFRMLITGLPELLGHCR------- 435
            :||..||..:..|..:      |||.|              .:.:|:...|.:|....       
Yeast   102 FCSEHCRTSYLQIPNI------IELIE--------------CYEILLHHFPSMLKRYNYTSEQEE 146

  Fly   436 -------KKPTLSKLWSAINGGLQERQDIAYSAVLRLERLKEERPT--DTVIALALAAHIL--SI 489
                   .:..:...|..|......|.:...||    :|:.:..||  |....:......|  ..
Yeast   147 KLNSILISENVIQSSWDEIESKWIPRINNMKSA----KRINQLPPTCEDEYCCIRFVCESLFNLK 207

  Fly   490 YLS-KCTTF--FDQLEKS-------LPTASRMSSAEWELLCAALLMRHIGQLRHRSLTACRSFVL 544
            |:. :|.|:  |:.|:.:       .|.........::.| ..||..|:    ||.|:      :
Yeast   208 YMDPQCITYRAFNMLQSNELSKISKFPVLLHFQKLVFQTL-YILLPSHL----HRMLS------I 261

  Fly   545 PADPHVFSPL--NEFQLWAAPMRLQEGHLHLLAGEVAVVSYSVYPDTLNLCRHSCSSTICAKFSG 607
            |...|:....  |.|.||      |||.   .:.......|.|:|:. :...|||:..|.....|
Yeast   262 PLLRHILGTEYGNAFGLW------QEGE---ASDSREYFGYWVFPEA-SYFNHSCNPNITKYRKG 316

  Fly   608 RTVTALALLDLPAGSGIYNCFAGGNFQQLPREERTKQLLESG-IRCHCNACQ 658
            .::......|:.....|  |........||..:|...|.:|. ..|.|..|:
Yeast   317 NSMLFTMNRDIKKDEQI--CIDYSGVLDLPTVKRRAFLADSWFFDCACERCK 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
daoNP_001260462.1 TPR_11 165..235 CDD:290150
TPR repeat 200..235 CDD:276809
TPR repeat 243..270 CDD:276809
zf-MYND 355..395 CDD:280009 5/16 (31%)
SET6NP_015160.1 SET <1..370 CDD:225491 63/312 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.