DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dao and SmydA-2

DIOPT Version :9

Sequence 1:NP_001260462.1 Gene:dao / 34891 FlyBaseID:FBgn0028862 Length:882 Species:Drosophila melanogaster
Sequence 2:NP_649084.1 Gene:SmydA-2 / 40075 FlyBaseID:FBgn0036839 Length:530 Species:Drosophila melanogaster


Alignment Length:634 Identity:127/634 - (20%)
Similarity:214/634 - (33%) Gaps:212/634 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   256 LRNFALCEEHLHELLHIELNQVFEARTH--ELWHQCEVLKVERFEMAVQTGDDLDINDSKAFEIA 318
            |.:.|||:....:|.....|.|:.:|.|  |.|.:....:.:.||:|  |.:.|           
  Fly     6 LTSCALCQAKASQLCAACRNVVYCSREHQKEHWKKGHRSECQCFEIA--TNEVL----------- 57

  Fly   319 WLDNSSSLHTTRAVAKNALIFESEAVAMVPS-GNCRVCDYCGITQFIP-------FPCIYCSNRL 375
                ...|..||.:.....|.:...:.:.|. .:..:|..|......|       ..|..||..|
  Fly    58 ----GRHLRATRDIKIGEQILKEAPLVLGPKVASAPLCLGCHRNLLAPGKPRGNYHKCSSCSWPL 118

  Fly   376 VVYCSRQCRFKHAAIHAVECFGHQIELFESFGEVFGMPRLLQLAFRMLITGLPELLGHCRKKPTL 440
               |.::|  :.:..|..||                          .|::|              
  Fly   119 ---CGKEC--EDSVHHKAEC--------------------------QLMSG-------------- 138

  Fly   441 SKLWSAIN--GGLQERQDIAYSAV--LRLERLKEERPTDTVIALALAAHILSIYLSKC--TTFFD 499
            |...|.||  .|.:||::.||..:  ||...||::.| |..:.|    :.|..:|.:.  |..:.
  Fly   139 SNFQSKINYVPGEEERKESAYCVIMLLRCMHLKDKDP-DAFLKL----YNLEDHLKERLETPLYQ 198

  Fly   500 QLEKSLPTASR--MSSAEWE----LLCAALLMRHIGQLRH-------RSLTACRSFV----LPAD 547
            .|..:|.|..:  :...:|.    |..||:|..:..::|.       |:|....:.:    :|..
  Fly   199 VLRANLITFIKTVLGMKDWPEMDILRIAAILDTNTFEVRQPRERRKIRALYPGAAMISHDCVPNM 263

  Fly   548 PHVFSPLNEFQLWAAPMRLQEGHLHLLAGEVAVVSY-----SVYPDTLNLCRHSCSSTICAK--- 604
            .|.|.  ::..:.....|      .:..||:..:||     |.....::|.:..|....||:   
  Fly   264 RHRFD--DDMNIVFLAKR------KIAKGEILSISYTQPLRSTIQRRVHLRQAKCFDCSCARCQD 320

  Fly   605 ------FSGRTVTALALLDLPAGSGIYNCFAGGNFQQLPREERTKQLLESG-IRCH-CN----AC 657
                  |:| ..|.|            .|.||......|       ||.|. .:|. ||    |.
  Fly   321 PEELGSFAG-AQTCL------------KCKAGKIISLNP-------LLNSAPWKCQLCNFKRSAK 365

  Fly   658 QLTHSDDQFHK----------------FHRYRCDNPNCMEIFTPNALPHAPSLRWWLSEEY---- 702
            .:..||.:..:                .:|:|.|      :...|.  |....::.|::.|    
  Fly   366 DVVTSDAELQQELESLDKTTPVALEEFIYRHRAD------LHETNT--HILQAKYALTQLYGSAP 422

  Fly   703 --TQPEFNGADL-IMCPHCGEYQKL----EWFWAF--------------TTSL-----IDCELIE 741
              ...|.:|..| .....|.|..||    :..|:.              |.:|     :||   |
  Fly   423 GFAMEELSGESLNRKLQLCEELLKLADIFDGGWSIFRGNLLIDMEEALVTQALRSKDPLDC---E 484

  Fly   742 ERCKLYAAIERAENQLMDLHECKVALARLLLEQCLMVHREGATVLDDWE 790
            |:.:..|.:.|....:|. ||.:  :.:||||:.:::    ::.|:.:|
  Fly   485 EKLRNAAEMLREIRNIMK-HEPE--MQQLLLERQVIL----SSALERFE 526

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
daoNP_001260462.1 TPR_11 165..235 CDD:290150
TPR repeat 200..235 CDD:276809
TPR repeat 243..270 CDD:276809 4/13 (31%)
zf-MYND 355..395 CDD:280009 10/46 (22%)
SmydA-2NP_649084.1 zf-MYND 9..46 CDD:280009 10/36 (28%)
SET <246..291 CDD:214614 8/52 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2084
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.