DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dao and SmydA-5

DIOPT Version :9

Sequence 1:NP_001260462.1 Gene:dao / 34891 FlyBaseID:FBgn0028862 Length:882 Species:Drosophila melanogaster
Sequence 2:NP_610202.3 Gene:SmydA-5 / 35538 FlyBaseID:FBgn0033061 Length:553 Species:Drosophila melanogaster


Alignment Length:559 Identity:109/559 - (19%)
Similarity:175/559 - (31%) Gaps:212/559 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   326 LHTTRAVAKNALIFESEAVAMVPSGNCRVCDYCGITQFIPFPCIYCSN--RLVVYCSRQCRF--- 385
            |..|:.:|...::|..|.:.:.|.......|    .:....||:.|..  ||..:..|:||:   
  Fly    58 LKVTQNIAAGQIVFIEEPLVVGPKWYLSDAD----KEASNVPCVGCYTPCRLGKHQCRRCRWPVC 118

  Fly   386 ----KHAAIHAVECFGHQIELFESFGEVFGMP-----RLLQLAFR---MLITGLPELLGHCRKKP 438
                ||   .::||      ...|.|.  |.|     |.|...||   :|:  |..||       
  Fly   119 SAGCKH---ESMEC------SVLSLGS--GSPTRADARSLNDYFRGDALLV--LKCLL------- 163

  Fly   439 TLSKLWSAINGGLQERQDIAYSAVLRLERLKEERPTDTVIALALAAHILSIYLSKCTTFFDQLEK 503
                        ||.:....:||:|.::..:|||                    |.|..:::.||
  Fly   164 ------------LQRQSPTKWSALLEMQSHEEER--------------------KGTDLYEEAEK 196

  Fly   504 SLPTASRMSSAEWELLCAALLMRHIGQLRHRSLTAC-------------RSFV---LPAD----- 547
            .:.|     ..:...||      .:.|.....||.|             .:|:   ||:.     
  Fly   197 RVVT-----YLQKRFLC------RLKQTNPNLLTDCGPEMLHRLCGIIETNFMVIELPSGVELSG 250

  Fly   548 --------PHVFSPLNEFQ-----------------------------LWAAPMRLQEGHLHLLA 575
                    .|...|..:||                             ||..  :|::.||.|  
  Fly   251 LFRQACMMEHACQPNCDFQFDNKTQQVAVRAGCDLRKGDHLRITYTNILWGT--QLRQHHLRL-- 311

  Fly   576 GEVAVVSYSVYPDTLNLCRHSCSSTICAKFSGRTVTALALLDLPAGSGIYNCFAGGNFQQLPREE 640
                ...:|        ||  ||..:.....|..::||..|      |..|...||.  .||.:.
  Fly   312 ----TKHFS--------CR--CSRCLDPTEYGTYISALTCL------GDVNQTCGGT--HLPVDP 354

  Fly   641 RTKQLLESGIRCHCNACQL-----------THSDDQFHKFHRYRCDNPNCMEIFT--------PN 686
                 |:...:..|:.|.:           :|..:|.... ...|.:.|.:|:..        ||
  Fly   355 -----LDENTQWKCDTCPMIVDGAYVAELQSHMTEQVEGL-LAGCPSANQVELLLARLTHMLHPN 413

  Fly   687 ALPHAPSLRWWLSEEYTQPEFNGADLIMCPH---------CGEY----QKLEWFWAFTTSLIDCE 738
            .. |..:|:..|.:.|....  |.:|.:..:         |||.    ::|:.:.......:...
  Fly   414 HF-HTFNLKHTLIQLYGNEA--GLELGVLSNTQLERKLRLCGELYNVCRRLDPYSIKLAIYVTVI 475

  Fly   739 LIEERCKLYAAIERAE---NQLMDLHECKVALARLLLEQ 774
            |||....|.....||.   ..|:.|.:.::..|.::||:
  Fly   476 LIEVAHTLQEQARRAPAEGTSLLGLAQSRLREAHMVLEK 514

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
daoNP_001260462.1 TPR_11 165..235 CDD:290150
TPR repeat 200..235 CDD:276809
TPR repeat 243..270 CDD:276809
zf-MYND 355..395 CDD:280009 11/48 (23%)
SmydA-5NP_610202.3 zf-MYND 7..43 CDD:280009
SET 185..295 CDD:279228 19/140 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473065
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2084
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.