DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dao and Smyd5

DIOPT Version :9

Sequence 1:NP_001260462.1 Gene:dao / 34891 FlyBaseID:FBgn0028862 Length:882 Species:Drosophila melanogaster
Sequence 2:NP_001101340.1 Gene:Smyd5 / 312503 RGDID:1309153 Length:417 Species:Rattus norvegicus


Alignment Length:450 Identity:92/450 - (20%)
Similarity:149/450 - (33%) Gaps:126/450 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   316 EIAWLDNS--SSLHTTRAVAKNALIF-ESEAVAMVPSGNC----RVCDYC------------GIT 361
            |:.::.::  ..|..|:.:.|...|| |...||.....|.    |.||:|            .:|
  Rat    24 EVRFVSSAKGKGLFATQLIRKGETIFIERPLVASQFLWNALYRYRACDHCLRALEKAEENAQRLT 88

  Fly   362 ----QFIPFPCIYCSNR----------LVVYCSRQCRFKHA-AIHAVECFG-------HQI-ELF 403
                |.:|.|.: ||.|          .|.|||.:||...| ..|.:.|.|       |.: :|.
  Rat    89 GKPGQVLPHPEL-CSVRKDLHQNCPRCQVTYCSAECRLAAAEQYHQILCPGPSQDDPRHPLNKLQ 152

  Fly   404 ESFGEVFGMPRLLQLAFRMLITGLPELLGHCRKKPTLSKLWSAI-NGGLQERQDIAYSAV----- 462
            |::..|...|   :.|..||:..:...:...:.|....:|:|.. :....|.::|.:..:     
  Rat   153 EAWRSVHYPP---ETASIMLMARMVATVKQAKDKDHWVRLFSHFCSKTANEEEEIVHKLLGDKFK 214

  Fly   463 LRLERLKEERPTDTVIALALAAHILSIYLSK--CTTFFDQLEKSLPTASRMSSAEWELLCAALLM 525
            .:||.|:.      :...||....||.:.:.  ..:.|..:..:.......|.::|...|.||  
  Rat   215 GQLELLRR------LFTEALYEETLSQWFTPDGFRSLFALVGTNGQGIGTSSLSQWVHACDAL-- 271

  Fly   526 RHIGQLRHRSLTACRSFVLPADPHVFSPLNEFQLWAAPMRLQEGHLHLLAGEVAVVSYSVYPDTL 590
                :|:.:......:|:......:.:...||      :..:...|.:|.               
  Rat   272 ----ELKPQEREQLDTFIDQLYKDIEAATGEF------LNCEGSGLFVLQ--------------- 311

  Fly   591 NLCRHSCSSTICAKFSGRT----VTALALLDLPAGSGIYNCFAGGNFQQLPREERTKQLLESGIR 651
            :.|.|||.......|....    ||||.  |:..|..|  |.:                      
  Rat   312 SCCNHSCVPNAETSFPENNFLLHVTALE--DIEPGEEI--CIS---------------------- 350

  Fly   652 CHCNACQLTHSDDQFHKFHR----YRCDNPNCM-EIFTPNALPHAPSLRWWLSEEYTQPE 706
             :.:.||...|....||..|    :.|..|.|: |...||.........   .||..:||
  Rat   351 -YLDCCQRERSRHSRHKILRENYLFVCSCPKCLAEADDPNVTSEEEEEE---DEEEGEPE 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
daoNP_001260462.1 TPR_11 165..235 CDD:290150
TPR repeat 200..235 CDD:276809
TPR repeat 243..270 CDD:276809
zf-MYND 355..395 CDD:280009 18/66 (27%)
Smyd5NP_001101340.1 DUF4599 68..144 CDD:292015 21/76 (28%)
SET <298..351 CDD:214614 17/100 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.