DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dao and set6

DIOPT Version :9

Sequence 1:NP_001260462.1 Gene:dao / 34891 FlyBaseID:FBgn0028862 Length:882 Species:Drosophila melanogaster
Sequence 2:NP_596514.1 Gene:set6 / 2541370 PomBaseID:SPBP8B7.07c Length:483 Species:Schizosaccharomyces pombe


Alignment Length:319 Identity:56/319 - (17%)
Similarity:96/319 - (30%) Gaps:115/319 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   353 RVCDYCGITQFIPFPCIYCSNRLVVYCSRQCRFKHAAIHAVECFGHQIELFESFGEVFGMPRLLQ 417
            |.|..|...:.....|..|  :::.|||:.|:......|.:||...|.......     :|.:.:
pombe    47 RTCSTCTEEKVKTQRCAAC--KIIHYCSKGCQKADWPFHKLECKALQASKQNGI-----LPSVCR 104

  Fly   418 LAFRMLITG------LPELLGHCRKKPTLSKLWSAINGGLQERQDIAYSAVLRLERLKEERPTDT 476
            |..|:.:..      :..:.||..:...:|..||                             |.
pombe   105 LLIRLYLLWQKNPAIIEPMEGHQNEFQAVSSSWS-----------------------------DA 140

  Fly   477 VIALALAAHILSIYLSKCTTFFDQLEKSLPTASRMSSAEWELLCAALLMRHIGQLRHRSLTACRS 541
            .:..:.|:|...||.::   .|.                 :|.|                     
pombe   141 ELIASAASHYTQIYQAE---LFQ-----------------KLFC--------------------- 164

  Fly   542 FVLPADPHVFSPLNEFQLWAAPMRLQEGHLHLLAGEVAVVSYSVYPDTLNLCR--HSCSSTICAK 604
                                   ||....::|:..  :..|..:..||: |||  |||.......
pombe   165 -----------------------RLAVNAMNLVTS--SFDSLGMCLDTI-LCRLNHSCDPNCQII 203

  Fly   605 FSGRTVTALALLDLPAGSGIYNCFAGGNFQQLPREERTKQLLES-GIRCHCNACQLTHS 662
            |.|..|..::..|:.....::..:..   .:||:..|.||||:. ...|:|..|:..|:
pombe   204 FDGAIVQLVSKRDIKKDEQLFISYID---IRLPKSIRQKQLLKKYFFSCYCPRCENDHT 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
daoNP_001260462.1 TPR_11 165..235 CDD:290150
TPR repeat 200..235 CDD:276809
TPR repeat 243..270 CDD:276809
zf-MYND 355..395 CDD:280009 9/39 (23%)
set6NP_596514.1 SET 5..483 CDD:225491 56/319 (18%)
zf-MYND 49..87 CDD:280009 9/39 (23%)
SET <142..227 CDD:279228 23/151 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.