DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZnT35C and MMT1

DIOPT Version :9

Sequence 1:NP_609741.3 Gene:ZnT35C / 34890 FlyBaseID:FBgn0028516 Length:472 Species:Drosophila melanogaster
Sequence 2:NP_013902.1 Gene:MMT1 / 855215 SGDID:S000004789 Length:510 Species:Saccharomyces cerevisiae


Alignment Length:150 Identity:35/150 - (23%)
Similarity:65/150 - (43%) Gaps:37/150 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 IAEIVGGVLSNSLAIATDAAHLLTDFASFMISLFAIWIAGRPSTQRMSFGWYRAEVIGAMASVFM 167
            |.:..||::.:|.|:..||.|.::|..|.:::|.::.:|....|....:|:.:.|.:|::| |..
Yeast   176 IGKFFGGIVFHSQALFADAIHAISDMVSDLLTLLSVGLAANKPTADYPYGYGKIETVGSLA-VST 239

  Fly   168 IWVITGILV-WLAIGRLISGDYEVNAKIMLITSGLAILVNVIMGVQLQHGHSHGLGGGHGHSHGG 231
            |..:.||.: |.::..|:               |..|...:|..:           |..||:|..
Yeast   240 ILAMAGISIGWSSLCALV---------------GPVIPHTIIDTI-----------GNLGHAHTY 278

  Fly   232 SK---------NASHVQATS 242
            |:         ||:.:.|.|
Yeast   279 SEDIIEDVTDINAAWIAAAS 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZnT35CNP_609741.3 CDF 100..457 CDD:273544 34/149 (23%)
Cation_efflux 100..378 CDD:279834 34/149 (23%)
MMT1NP_013902.1 FieF 150..488 CDD:223131 34/149 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344808
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.