DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZnT35C and SLC30A3

DIOPT Version :9

Sequence 1:NP_609741.3 Gene:ZnT35C / 34890 FlyBaseID:FBgn0028516 Length:472 Species:Drosophila melanogaster
Sequence 2:XP_005264604.1 Gene:SLC30A3 / 7781 HGNCID:11014 Length:412 Species:Homo sapiens


Alignment Length:159 Identity:58/159 - (36%)
Similarity:80/159 - (50%) Gaps:42/159 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IAKRD----SGRTRRSNYGTAPSFHLMEQGQPGVNVVAGNGNNNHPATPATPAQIFCLHGRSNNV 69
            ::.||    .|..|..:..|.||..|.|:.:|                                |
Human    16 VSPRDRGGAGGSLRLKSLFTEPSEPLPEESKP--------------------------------V 48

  Fly    70 EVR-DHCHR--ARSEGVD---VKARRKLIIASILCLVFMIAEIVGGVLSNSLAIATDAAHLLTDF 128
            |:. .||||  ....|:.   :.|||:|..|..:|.|||..|:|||.|::||||.|||||||.|.
Human    49 EMPFHHCHRDPLPPPGLTPERLHARRQLYAACAVCFVFMAGEVVGGYLAHSLAIMTDAAHLLADV 113

  Fly   129 ASFMISLFAIWIAGRPSTQRMSFGWYRAE 157
            .|.|.|||::|::.||:|:.|:|||:|:|
Human   114 GSMMGSLFSLWLSTRPATRTMTFGWHRSE 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZnT35CNP_609741.3 CDF 100..457 CDD:273544 35/58 (60%)
Cation_efflux 100..378 CDD:279834 35/58 (60%)
SLC30A3XP_005264604.1 Cation_efflux 85..>142 CDD:279834 34/56 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152429
Domainoid 1 1.000 186 1.000 Domainoid score I3351
eggNOG 1 0.900 - - E1_COG1230
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 232 1.000 Inparanoid score I3434
Isobase 1 0.950 - 0 Normalized mean entropy S2202
OMA 1 1.010 - - QHG53838
OrthoDB 1 1.010 - - D351752at33208
OrthoFinder 1 1.000 - - FOG0000470
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100508
Panther 1 1.100 - - O PTHR11562
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X541
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.720

Return to query results.
Submit another query.