DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZnT35C and Slc30a7

DIOPT Version :9

Sequence 1:NP_609741.3 Gene:ZnT35C / 34890 FlyBaseID:FBgn0028516 Length:472 Species:Drosophila melanogaster
Sequence 2:NP_001178644.1 Gene:Slc30a7 / 310801 RGDID:1307873 Length:378 Species:Rattus norvegicus


Alignment Length:393 Identity:95/393 - (24%)
Similarity:178/393 - (45%) Gaps:67/393 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 KARRKLIIASILCLVFMIAEIVGGVLSNSLAIATDAAHLLTDFASFMISLFAIWIAGRPSTQRMS 150
            |..|.|.....|.|.|...|::.|:.||.|.:.:|:.|:..|..:.:..|.|..|:........|
  Rat    33 KTSRNLFFFLCLNLSFAFVELLYGIWSNCLGLISDSFHMFFDSTAILAGLAASVISKWRDNDAFS 97

  Fly   151 FGWYRAEVI-GAMASVFMIWVITGILVWL-AIGRLISGDYEVNAKIMLITSGLAILVNVIMGVQL 213
            :|:.||||: |.:..:|:|:  |...::. .:.|.::.. :|:.:.:|:.|.|..:||::.....
  Rat    98 YGYVRAEVLAGFVNGLFLIF--TAFFIFSEGVERALAPP-DVHHERLLLVSILGFVVNLVGIFVF 159

  Fly   214 QH-GHSHGLGGGHGHSH---GGSKNASHVQATSTPCSDSPSQRIEGGVAYAPEDAELPGGGLPTF 274
            .| ||.|..|.||||||   .|:.:.||  .....|.   |...:.|.|::.:.....|.|    
  Rat   160 NHGGHGHSHGSGHGHSHSLFNGALDHSH--GHEDHCH---SHGAKHGGAHSHDHDHAHGHG---- 215

  Fly   275 SYQNTKLVDPTLDLEIAAVLAETAPGSHHHGGPVGREAVNMN---VRAALIHVIGDVIQSVGVFV 336
                                     ..|.|.||..:|....:   ::...:|::.|.:.|:||..
  Rat   216 -------------------------HLHSHDGPSFKETAGPSRQILQGVFLHILADTLGSIGVIA 255

  Fly   337 AA------GVIYFWPEYSIVDPICTFVFSIIVLFTTFTIMKDALLVLMEGTPNYMHYAEVL-QIF 394
            :|      |::       |.||||:.:.:|:::.:...::::::.:||:.||..:.  .|| |.:
  Rat   256 SAIMMQNFGLM-------IADPICSILIAILIVVSVIPLLRESIGILMQRTPPSLE--NVLPQCY 311

  Fly   395 QGIEGVERVHNLR---IWALSINKVALSAHLAIAENANPKRILDAATSAVHLRYNFFETTIQIED 456
            |.::.::.|:||:   .|.|..:....:..|.:|.:|:.:.|| :.|..:..:....:..:|| |
  Rat   312 QRVQQLQGVYNLQEQHFWTLCSDVYVGTLKLVVAPDADARWIL-SQTHNIFTQAGVRQLYVQI-D 374

  Fly   457 YTA 459
            :.|
  Rat   375 FAA 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZnT35CNP_609741.3 CDF 100..457 CDD:273544 88/375 (23%)
Cation_efflux 100..378 CDD:279834 67/292 (23%)
Slc30a7NP_001178644.1 CzcD 31..376 CDD:224151 94/390 (24%)
His-rich loop 161..220 21/92 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 186..228 12/75 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1230
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.