DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZnT35C and Slc30a5

DIOPT Version :9

Sequence 1:NP_609741.3 Gene:ZnT35C / 34890 FlyBaseID:FBgn0028516 Length:472 Species:Drosophila melanogaster
Sequence 2:NP_001099874.1 Gene:Slc30a5 / 294698 RGDID:1306931 Length:760 Species:Rattus norvegicus


Alignment Length:411 Identity:97/411 - (23%)
Similarity:171/411 - (41%) Gaps:104/411 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 RKLIIASILCLVFMIAEIVGGVLSNSLAIATDAAHLLTDFASFMISLFAIWIAGRPSTQRMSFGW 153
            |::.....|.|:|...|:..|||:|||.:.:|..|:|.|.::.::.|||..::...:|:..|:|:
  Rat   415 RQIFYFLCLNLLFTFVELFYGVLTNSLGLISDGFHMLFDCSALVMGLFAALVSRWKATRIFSYGY 479

  Fly   154 YRAEVI-GAMASVFMIWVITGILVWL-AIGRLISGDYEVNAKIMLITSGLAILVNVIMGVQLQHG 216
            .|.|:: |.:..:|:|  :....|:| ::.|||... |::..::...|...::||:|......|.
  Rat   480 GRIEILSGFINGLFLI--VIAFFVFLESVARLIDPP-ELDTNMLTPVSIGGLIVNLIGVCAFSHA 541

  Fly   217 HSHGLGGGHGHSHGGSKNASHVQATSTPCSDSPSQRIEGGVAYAPEDAELPGGGLPTFSYQNTKL 281
            ||||.|...||.|....::.|....|                                       
  Rat   542 HSHGHGPSQGHCHSDHGHSHHAHGHS--------------------------------------- 567

  Fly   282 VDPTLDLEIAAVLAETAPGSHHHGGPVGREAVNMNVRAALIHVIGDVIQSVGVFVAAGVI--YFW 344
                             ...|.||...|  .:|.|:|...:||:.|.:.|:||.|:..:|  :.|
  Rat   568 -----------------DHGHSHGFTGG--GMNANMRGVFLHVLADTLGSIGVIVSTVLIEQFGW 613

  Fly   345 PEYSIVDPICTFVFSIIVLFTTFTIMKDAL-LVLMEGTPNY---MHYAEVLQIFQGIEGVERVHN 405
               .|.||:|:...::::..:...::|||. ::|:...|:|   :|.|  |:..|.:||:....:
  Rat   614 ---FIADPLCSLFIAVLIFLSVIPLIKDACQVLLLRLPPDYEKELHIA--LEKVQKLEGLISYRD 673

  Fly   406 LRIWALSINKVALSAHLAIAENANPKRILDAAT-----SAVHLRYNFFETTIQIED--------- 456
            ...|..|.:.||.:.|:.:..:...:|::...|     :.|:      ..|||:|.         
  Rat   674 PHFWRHSASIVAGTIHIQVTSDVLEQRVVQQVTGILKDAGVN------NLTIQVEKEAYFQHMSG 732

  Fly   457 ----------YTAQMESCLQC 467
                      .|.||||...|
  Rat   733 LSTGFHDVLAMTQQMESMKYC 753

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZnT35CNP_609741.3 CDF 100..457 CDD:273544 88/388 (23%)
Cation_efflux 100..378 CDD:279834 67/282 (24%)
Slc30a5NP_001099874.1 CDF 426..724 CDD:273544 88/369 (24%)
Cation_efflux 426..644 CDD:279834 67/281 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1230
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.