DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZnT35C and SLC30A7

DIOPT Version :9

Sequence 1:NP_609741.3 Gene:ZnT35C / 34890 FlyBaseID:FBgn0028516 Length:472 Species:Drosophila melanogaster
Sequence 2:NP_001138356.1 Gene:SLC30A7 / 148867 HGNCID:19306 Length:376 Species:Homo sapiens


Alignment Length:391 Identity:93/391 - (23%)
Similarity:176/391 - (45%) Gaps:65/391 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 KARRKLIIASILCLVFMIAEIVGGVLSNSLAIATDAAHLLTDFASFMISLFAIWIAGRPSTQRMS 150
            |..|.|.....|.|.|...|::.|:.||.|.:.:|:.|:..|..:.:..|.|..|:........|
Human    33 KTSRNLFFFLCLNLSFAFVELLYGIWSNCLGLISDSFHMFFDSTAILAGLAASVISKWRDNDAFS 97

  Fly   151 FGWYRAEVI-GAMASVFMIWVITGILVWL-AIGRLISGDYEVNAKIMLITSGLAILVNVIMGVQL 213
            :|:.||||: |.:..:|:|:  |...::. .:.|.::.. :|:.:.:|:.|.|..:||:|.....
Human    98 YGYVRAEVLAGFVNGLFLIF--TAFFIFSEGVERALAPP-DVHHERLLLVSILGFVVNLIGIFVF 159

  Fly   214 QH-GHSHGLGGGHGHSH---GGSKNASHVQATSTPCSDSPSQRIEGGVAYAPEDAELPGGGLPTF 274
            :| ||.|..|.||||||   .|:.:.:|.....  |.   |..::.|.|::.:.|.  |.|    
Human   160 KHGGHGHSHGSGHGHSHSLFNGALDQAHGHVDH--CH---SHEVKHGAAHSHDHAH--GHG---- 213

  Fly   275 SYQNTKLVDPTLDLEIAAVLAETAPGSHHHGGPVGREAVNMN---VRAALIHVIGDVIQSVGVFV 336
                                     ..|.|.||..:|....:   ::...:|::.|.:.|:||..
Human   214 -------------------------HFHSHDGPSLKETTGPSRQILQGVFLHILADTLGSIGVIA 253

  Fly   337 AA------GVIYFWPEYSIVDPICTFVFSIIVLFTTFTIMKDALLVLMEGTPNYMHYA--EVLQI 393
            :|      |::       |.||||:.:.:|:::.:...::::::.:||:.||..:..:  :..|.
Human   254 SAIMMQNFGLM-------IADPICSILIAILIVVSVIPLLRESVGILMQRTPPLLENSLPQCYQR 311

  Fly   394 FQGIEGVERVHNLRIWALSINKVALSAHLAIAENANPKRILDAATSAVHLRYNFFETTIQIEDYT 458
            .|.::||..:.....|.|..:....:..|.:|.:|:.:.|| :.|..:..:....:..:|| |:.
Human   312 VQQLQGVYSLQEQHFWTLCSDVYVGTLKLIVAPDADARWIL-SQTHNIFTQAGVRQLYVQI-DFA 374

  Fly   459 A 459
            |
Human   375 A 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZnT35CNP_609741.3 CDF 100..457 CDD:273544 86/373 (23%)
Cation_efflux 100..378 CDD:279834 68/292 (23%)
SLC30A7NP_001138356.1 CzcD 31..374 CDD:224151 92/388 (24%)
Cation_efflux 48..294 CDD:279834 68/291 (23%)
His-rich loop 161..218 21/92 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 194..226 10/65 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1230
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.