DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4168 and cDIP

DIOPT Version :9

Sequence 1:NP_001285953.1 Gene:CG4168 / 34889 FlyBaseID:FBgn0028888 Length:1330 Species:Drosophila melanogaster
Sequence 2:NP_650951.1 Gene:cDIP / 42512 FlyBaseID:FBgn0038865 Length:554 Species:Drosophila melanogaster


Alignment Length:439 Identity:110/439 - (25%)
Similarity:183/439 - (41%) Gaps:86/439 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   800 SHAFGDLEFLEILNVAHNNLTSLRRRSFQGLNSLQELDLSHNQLDQLQVEQFS-NLRKLRILRIN 863
            ::..||.|....|...:...|:...|.|..| .:.|||:....:..:..|.|| ...||.||.::
  Fly    86 TYEVGDEEHSRTLIFENCTFTNFPLRLFYTL-EVSELDMRGCGIRFIYWENFSIGADKLVILLLS 149

  Fly   864 SNRLRALPREVFMNT-RLEFLDIAENQLSVWPVPAFTDIGFTLRSIQMSHNNLEYLDASMFINSQ 927
            .|.:..||.:.|... .|||:.:..|:|......||.:: ..|:.:.::.|.||.|.|.:|...:
  Fly   150 DNHIEVLPTKTFRGAGNLEFIFLNRNKLGKLQAGAFDNL-LKLQYLDLTENRLEALAADVFAGLK 213

  Fly   928 FLYDISLARNRITILPDNTFSFLNNLTNLDLSQNPLVTTNLREVFVHTPRLRKLSLHHMGLYVLP 992
            .|..:.||.|::|.:..:.|:.     |.||....:....||||..:..|.|  ..||.      
  Fly   214 SLRHVGLAGNQLTTIESDLFAH-----NPDLLSVAMQNNRLREVGEYAFRSR--GRHHQ------ 265

  Fly   993 PLKLPLLSYLDVSGNYLQELSPLGSLRHLRHVNVSHNKLTNASCAAE--HLPPSVRVLDLAHNPL 1055
                  :.|:|:|.|  .||..|       .:|::...||..:|:.:  :|..||..:||:.|.:
  Fly   266 ------MQYVDLSNN--PELVVL-------LLNINATNLTARNCSLDRVNLYGSVTNVDLSDNRV 315

  Fly  1056 RRITLHDLASLRHLAELNILDVKVTNPQAFSKLRSLRKLHASSHANLGEIVA--RIPGLQQLRVH 1118
            |.:......:|.||...|...|::.   :.|::..||.|..:.:.|||::..  |.|.|:.|.:.
  Fly   316 RELYFPASEALEHLVLRNNSLVQLA---SLSRVPRLRHLDVADNPNLGQLPDGWRTPHLEMLVLR 377

  Fly  1119 CLEPNIGQQLFAKLANNTKIRLLELYGSNVQTIAP-DVFTGLSRSQRLQVKISHTRISDLPPGIF 1182
                |.||              :||         | :...|:...|:|.  ||...::::.|..|
  Fly   378 ----NTGQ--------------MEL---------PLEALQGMQNLQKLD--ISGNNLTEIDPSAF 413

  Fly  1183 YALREVPHLSIDISHNRINALAADSFYPNKSYWDAVGTRSIMGGLITSH 1231
            ..|.::.|                 ||.:.:.|:....|:||..||.::
  Fly   414 PTLTQLTH-----------------FYIHGNNWNCFSLRNIMDVLIRAN 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4168NP_001285953.1 leucine-rich repeat 99..118 CDD:275380
LRR_8 121..181 CDD:290566
LRR_RI 122..350 CDD:238064
leucine-rich repeat 122..146 CDD:275380
leucine-rich repeat 147..170 CDD:275380
leucine-rich repeat 171..194 CDD:275380
leucine-rich repeat 195..214 CDD:275380
leucine-rich repeat 215..236 CDD:275380
LRR_8 265..322 CDD:290566
leucine-rich repeat 266..287 CDD:275380
leucine-rich repeat 288..311 CDD:275380
leucine-rich repeat 312..338 CDD:275380
LRR_RI 315..546 CDD:238064
leucine-rich repeat 339..365 CDD:275380
LRR_8 365..424 CDD:290566
leucine-rich repeat 366..388 CDD:275380
leucine-rich repeat 389..412 CDD:275380
LRR_8 413..470 CDD:290566
leucine-rich repeat 414..436 CDD:275380
leucine-rich repeat 437..459 CDD:275380
leucine-rich repeat 460..483 CDD:275380
LRR_8 482..545 CDD:290566
leucine-rich repeat 484..510 CDD:275380
leucine-rich repeat 511..534 CDD:275380
leucine-rich repeat 535..589 CDD:275380
LRR_RI 588..891 CDD:238064 26/92 (28%)
LRR_8 588..650 CDD:290566
leucine-rich repeat 590..613 CDD:275380
leucine-rich repeat 614..639 CDD:275380
LRR_8 638..698 CDD:290566
leucine-rich repeat 640..663 CDD:275380
leucine-rich repeat 664..687 CDD:275380
LRR_8 688..749 CDD:290566
leucine-rich repeat 688..711 CDD:275380
leucine-rich repeat 712..735 CDD:275380
leucine-rich repeat 740..783 CDD:275380
LRR_8 784..843 CDD:290566 11/42 (26%)
leucine-rich repeat 785..808 CDD:275380 2/7 (29%)
leucine-rich repeat 809..832 CDD:275380 5/22 (23%)
LRR_RI <827..1053 CDD:238064 63/229 (28%)
LRR_8 832..890 CDD:290566 18/59 (31%)
leucine-rich repeat 833..856 CDD:275380 6/23 (26%)
leucine-rich repeat 857..879 CDD:275380 7/22 (32%)
leucine-rich repeat 880..900 CDD:275380 7/19 (37%)
LRR_8 904..963 CDD:290566 16/58 (28%)
leucine-rich repeat 905..928 CDD:275380 7/22 (32%)
leucine-rich repeat 929..952 CDD:275380 6/22 (27%)
leucine-rich repeat 953..977 CDD:275380 7/23 (30%)
leucine-rich repeat 978..1020 CDD:275380 10/41 (24%)
LRR_8 1019..1074 CDD:290566 14/56 (25%)
leucine-rich repeat 1045..1068 CDD:275380 6/22 (27%)
leucine-rich repeat 1069..1090 CDD:275380 4/20 (20%)
leucine-rich repeat 1091..1114 CDD:275380 9/24 (38%)
leucine-rich repeat 1115..1161 CDD:275380 8/46 (17%)
leucine-rich repeat 1162..1190 CDD:275380 7/27 (26%)
cDIPNP_650951.1 leucine-rich repeat 118..142 CDD:275380 6/23 (26%)
LRR_RI 143..407 CDD:238064 83/324 (26%)
leucine-rich repeat 143..166 CDD:275380 7/22 (32%)
LRR_8 166..225 CDD:290566 18/59 (31%)
leucine-rich repeat 167..190 CDD:275380 7/23 (30%)
leucine-rich repeat 191..214 CDD:275380 7/22 (32%)
leucine-rich repeat 215..238 CDD:275380 7/27 (26%)
leucine-rich repeat 239..265 CDD:275380 8/27 (30%)
leucine-rich repeat 266..325 CDD:275380 18/67 (27%)
LRR_8 304..357 CDD:290566 15/55 (27%)
leucine-rich repeat 326..347 CDD:275380 6/23 (26%)
leucine-rich repeat 348..394 CDD:275380 17/72 (24%)
LRR_8 369..428 CDD:290566 20/104 (19%)
LRR_4 393..433 CDD:289563 11/58 (19%)
leucine-rich repeat 395..418 CDD:275380 7/24 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453646
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45617
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.