DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4168 and CG5096

DIOPT Version :9

Sequence 1:NP_001285953.1 Gene:CG4168 / 34889 FlyBaseID:FBgn0028888 Length:1330 Species:Drosophila melanogaster
Sequence 2:NP_723576.1 Gene:CG5096 / 34410 FlyBaseID:FBgn0032235 Length:491 Species:Drosophila melanogaster


Alignment Length:506 Identity:113/506 - (22%)
Similarity:182/506 - (35%) Gaps:168/506 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   643 IDLSYNGLERLEAQTFHSLGD----LQTLNLQSNRLRTIARHAFHNLEFLRYLDLSYNRLVNISH 703
            :|.|....:.|.|:.:..|.:    .:|:||:.|.|.::.....:::|   .|.|:.|::.:||.
  Fly    59 LDCSEKLQDWLSAEDWEDLTNGNVVFKTINLEHNNLTSVPILPKYDVE---NLYLANNQIDSISV 120

  Fly   704 GAFTVLPNLAALDLMHNQLCSLSLKSFLYVSNTTTPLRLNVSHNHIASFYDELSSYMYIYQLDIS 768
            |||..|..|..|||.||:|          .|....|                          |:.
  Fly   121 GAFQNLTELVTLDLSHNRL----------TSKVLVP--------------------------DVF 149

  Fly   769 HNHVTKSDSFTNLANTLRFLNLAHNQLGSLQSHAFGDLEFLEILNVAHNN---LTSLRRRSFQGL 830
            ....|..| |.:|.| |:.|||.:|.|.||.:..|..:..:|.|.:..|:   :..|...:..||
  Fly   150 KGPFTVQD-FESLEN-LKTLNLGYNDLHSLDADLFEHIPHIEELVLCSNSFHVIDQLSETAISGL 212

  Fly   831 NSLQELDLSHNQLDQLQVEQFSNLRKLRILRINSNRLRALPREVFMNTRLEFLDIAENQL----- 890
            .||:.||:|:.::|.|........|.|.|.....|....||:.:...|.|..|.:.||.:     
  Fly   213 QSLKILDVSYMEIDDLPDTILHGPRDLEIFIAAGNLFNQLPKALKYATNLTSLVLNENPIENLIG 277

  Fly   891 -SVWPVPAFTDIGFTLRSIQMSHNNLEYLDASMFINSQFLYDISLARNRITILPDNTFSFLNNLT 954
             :|:| |.          .:::|.::.::..        ||.|.          ...||.|.:||
  Fly   278 DNVFP-PL----------TKLTHLSMTFMSK--------LYKIG----------PGAFSELQSLT 313

  Fly   955 NLDLSQNPLVTTNLREV-------------FVHTPRLRKLSLHHMGLYVLPPLKLPLLSYLDVSG 1006
            .|.||.|.|    |.|:             ::..|.|.|:.|::..:..||              
  Fly   314 ELILSDNKL----LNEIDEEALSKNVTGGQYLDYPPLEKVYLNNCNVSTLP-------------- 360

  Fly  1007 NYLQELSPLGSLRHLRHVNVSHNKLTNASCAAEHLPPSVRVLDLAHNPLRRITLHDLASLRHLAE 1071
                           :.:.|..:||              :.|||..||......:|..       
  Fly   361 ---------------KELLVRWDKL--------------KALDLRFNPWNCDESNDFL------- 389

  Fly  1072 LNIL-------------DVKVTNPQAFSKLRSLRKLHASSH---ANLGEIV 1106
            :|:|             |||...|...:.:..||.  |:.|   ::.|.::
  Fly   390 INVLIDRINKTTPVLAKDVKCGGPNKLNDVTLLRV--ANEHMIESSTGSLI 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4168NP_001285953.1 leucine-rich repeat 99..118 CDD:275380
LRR_8 121..181 CDD:290566
LRR_RI 122..350 CDD:238064
leucine-rich repeat 122..146 CDD:275380
leucine-rich repeat 147..170 CDD:275380
leucine-rich repeat 171..194 CDD:275380
leucine-rich repeat 195..214 CDD:275380
leucine-rich repeat 215..236 CDD:275380
LRR_8 265..322 CDD:290566
leucine-rich repeat 266..287 CDD:275380
leucine-rich repeat 288..311 CDD:275380
leucine-rich repeat 312..338 CDD:275380
LRR_RI 315..546 CDD:238064
leucine-rich repeat 339..365 CDD:275380
LRR_8 365..424 CDD:290566
leucine-rich repeat 366..388 CDD:275380
leucine-rich repeat 389..412 CDD:275380
LRR_8 413..470 CDD:290566
leucine-rich repeat 414..436 CDD:275380
leucine-rich repeat 437..459 CDD:275380
leucine-rich repeat 460..483 CDD:275380
LRR_8 482..545 CDD:290566
leucine-rich repeat 484..510 CDD:275380
leucine-rich repeat 511..534 CDD:275380
leucine-rich repeat 535..589 CDD:275380
LRR_RI 588..891 CDD:238064 68/260 (26%)
LRR_8 588..650 CDD:290566 2/6 (33%)
leucine-rich repeat 590..613 CDD:275380
leucine-rich repeat 614..639 CDD:275380
LRR_8 638..698 CDD:290566 14/58 (24%)
leucine-rich repeat 640..663 CDD:275380 5/19 (26%)
leucine-rich repeat 664..687 CDD:275380 5/22 (23%)
LRR_8 688..749 CDD:290566 18/60 (30%)
leucine-rich repeat 688..711 CDD:275380 9/22 (41%)
leucine-rich repeat 712..735 CDD:275380 7/22 (32%)
leucine-rich repeat 740..783 CDD:275380 5/42 (12%)
LRR_8 784..843 CDD:290566 20/61 (33%)
leucine-rich repeat 785..808 CDD:275380 9/22 (41%)
leucine-rich repeat 809..832 CDD:275380 6/25 (24%)
LRR_RI <827..1053 CDD:238064 51/244 (21%)
LRR_8 832..890 CDD:290566 18/57 (32%)
leucine-rich repeat 833..856 CDD:275380 6/22 (27%)
leucine-rich repeat 857..879 CDD:275380 5/21 (24%)
leucine-rich repeat 880..900 CDD:275380 7/25 (28%)
LRR_8 904..963 CDD:290566 13/58 (22%)
leucine-rich repeat 905..928 CDD:275380 1/22 (5%)
leucine-rich repeat 929..952 CDD:275380 6/22 (27%)
leucine-rich repeat 953..977 CDD:275380 9/36 (25%)
leucine-rich repeat 978..1020 CDD:275380 5/41 (12%)
LRR_8 1019..1074 CDD:290566 9/54 (17%)
leucine-rich repeat 1045..1068 CDD:275380 6/22 (27%)
leucine-rich repeat 1069..1090 CDD:275380 6/33 (18%)
leucine-rich repeat 1091..1114 CDD:275380 5/19 (26%)
leucine-rich repeat 1115..1161 CDD:275380
leucine-rich repeat 1162..1190 CDD:275380
CG5096NP_723576.1 LRR_RI 69..378 CDD:238064 97/425 (23%)
leucine-rich repeat 85..104 CDD:275380 5/18 (28%)
LRR_8 105..174 CDD:290566 30/109 (28%)
leucine-rich repeat 105..128 CDD:275380 10/25 (40%)
leucine-rich repeat 129..163 CDD:275380 14/70 (20%)
LRR_8 163..222 CDD:290566 20/59 (34%)
leucine-rich repeat 164..187 CDD:275380 9/22 (41%)
leucine-rich repeat 188..214 CDD:275380 6/25 (24%)
leucine-rich repeat 215..238 CDD:275380 6/22 (27%)
leucine-rich repeat 239..261 CDD:275380 5/21 (24%)
LRR_8 260..322 CDD:290566 21/90 (23%)
leucine-rich repeat 262..286 CDD:275380 7/34 (21%)
leucine-rich repeat 287..311 CDD:275380 7/41 (17%)
leucine-rich repeat 346..369 CDD:275380 6/51 (12%)
leucine-rich repeat 370..388 CDD:275380 6/31 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45617
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.