DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4168 and TSKU

DIOPT Version :10

Sequence 1:NP_609740.4 Gene:CG4168 / 34889 FlyBaseID:FBgn0028888 Length:1330 Species:Drosophila melanogaster
Sequence 2:NP_001305406.1 Gene:TSKU / 25987 HGNCID:28850 Length:367 Species:Homo sapiens


Alignment Length:311 Identity:91/311 - (29%)
Similarity:142/311 - (45%) Gaps:53/311 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   723 CSLSLKSF-LYVSNTTT--------------PLRLNVSHNHIASFYDELSSYMYIYQLDISHNHV 772
            |...:::| |:.|.:.|              |:.|:.:|..::|           .:|::.:..|
Human    38 CQCEVETFGLFDSFSLTRVDCSGLGPHIMPVPIPLDTAHLDLSS-----------NRLEMVNESV 91

  Fly   773 TKSDSFTNLANTLRFLNLAHNQLGSLQSHAFGDLEFLEILNVAHNNLTSLRRRSFQGLNSLQELD 837
            .....:|.||.    |:|:||.|.|:...||..|.:||.|:::||.||:|...||.. :.|.:::
Human    92 LAGPGYTTLAG----LDLSHNLLTSISPTAFSRLRYLESLDLSHNGLTALPAESFTS-SPLSDVN 151

  Fly   838 LSHNQLDQLQVEQFSNLRKLRILRIN-SNRL--RALPREVFMNTR-------LEFLDIAENQLSV 892
            ||||||.::.|..|:...:.|.|.:: |:.|  |.:|..    ||       ::.|::|.|:|..
Human   152 LSHNQLREVSVSAFTTHSQGRALHVDLSHNLIHRLVPHP----TRAGLPAPTIQSLNLAWNRLHA 212

  Fly   893 WPVPAFTDIGFTLRSIQMSHNNLEYLDASMFINSQFLYDISLAR-NRITILPDNTFSFLNNLTNL 956
              ||...|:  .||.:.:..|.|..:....|.....|..:|||. .|:..|..:.|..|..|..|
Human   213 --VPNLRDL--PLRYLSLDGNPLAVIGPGAFAGLGGLTHLSLASLQRLPELAPSGFRELPGLQVL 273

  Fly   957 DLSQNPLVTTNLREVFVHTPRLRKLSLHHMGLYVLPP---LKLPLLSYLDV 1004
            |||.||.:.....|||.....|::|.|....|..||.   |.||.|..:.|
Human   274 DLSGNPKLNWAGAEVFSGLSSLQELDLSGTNLVPLPEALLLHLPALQSVSV 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4168NP_609740.4 PRK15370 <69..>353 CDD:185268
leucine-rich repeat 99..118 CDD:275380
leucine-rich repeat 122..146 CDD:275380
leucine-rich repeat 147..170 CDD:275380
leucine-rich repeat 171..194 CDD:275380
leucine-rich repeat 195..214 CDD:275380
leucine-rich repeat 215..236 CDD:275380
leucine-rich repeat 266..287 CDD:275380
leucine-rich repeat 288..311 CDD:275380
leucine-rich repeat 312..338 CDD:275380
LRR <338..651 CDD:443914
leucine-rich repeat 339..365 CDD:275380
leucine-rich repeat 366..388 CDD:275380
leucine-rich repeat 389..412 CDD:275380
leucine-rich repeat 414..436 CDD:275380
leucine-rich repeat 437..459 CDD:275380
leucine-rich repeat 460..483 CDD:275380
leucine-rich repeat 484..510 CDD:275380
leucine-rich repeat 511..534 CDD:275380
leucine-rich repeat 535..589 CDD:275380
LRR 543..971 CDD:443914 77/273 (28%)
leucine-rich repeat 590..613 CDD:275380
leucine-rich repeat 614..639 CDD:275380
leucine-rich repeat 640..663 CDD:275380
leucine-rich repeat 664..687 CDD:275380
leucine-rich repeat 688..711 CDD:275380
leucine-rich repeat 712..735 CDD:275380 3/12 (25%)
leucine-rich repeat 740..783 CDD:275380 7/42 (17%)
leucine-rich repeat 785..808 CDD:275380 9/22 (41%)
leucine-rich repeat 809..832 CDD:275380 10/22 (45%)
leucine-rich repeat 833..856 CDD:275380 9/22 (41%)
leucine-rich repeat 857..879 CDD:275380 6/24 (25%)
leucine-rich repeat 880..900 CDD:275380 6/19 (32%)
leucine-rich repeat 905..928 CDD:275380 5/22 (23%)
LRR 911..>1203 CDD:443914 32/98 (33%)
leucine-rich repeat 929..952 CDD:275380 8/23 (35%)
leucine-rich repeat 953..977 CDD:275380 10/23 (43%)
leucine-rich repeat 978..1020 CDD:275380 11/30 (37%)
leucine-rich repeat 1045..1068 CDD:275380
leucine-rich repeat 1069..1090 CDD:275380
leucine-rich repeat 1091..1114 CDD:275380
leucine-rich repeat 1115..1161 CDD:275380
leucine-rich repeat 1162..1190 CDD:275380
PCC 1230..>1298 CDD:188093
TSKUNP_001305406.1 leucine-rich repeat 76..99 CDD:275380 4/33 (12%)
LRR <98..>321 CDD:443914 79/235 (34%)
leucine-rich repeat 100..123 CDD:275380 11/26 (42%)
leucine-rich repeat 124..145 CDD:275380 10/21 (48%)
leucine-rich repeat 147..170 CDD:275380 9/22 (41%)
leucine-rich repeat 171..197 CDD:275380 8/29 (28%)
leucine-rich repeat 200..219 CDD:275380 6/20 (30%)
leucine-rich repeat 221..244 CDD:275380 5/22 (23%)
leucine-rich repeat 245..269 CDD:275380 8/23 (35%)
leucine-rich repeat 270..294 CDD:275380 10/23 (43%)
leucine-rich repeat 295..316 CDD:275380 7/20 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.