DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4168 and LRRC15

DIOPT Version :9

Sequence 1:NP_001285953.1 Gene:CG4168 / 34889 FlyBaseID:FBgn0028888 Length:1330 Species:Drosophila melanogaster
Sequence 2:NP_001128529.2 Gene:LRRC15 / 131578 HGNCID:20818 Length:587 Species:Homo sapiens


Alignment Length:395 Identity:124/395 - (31%)
Similarity:198/395 - (50%) Gaps:38/395 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   368 ALNLEQNFVTQLPEAVF-KATGIAHLVLAFNAISRVHPSAFEGLTETLEYLDLERNRLTTVPVAL 431
            :|.:....:|:|.|:.| ..:.:..|.:..|.:||:.|.||..| .:|.||.|..|:|..:|:.|
Human    63 SLQILNTHITELNESPFLNISALIALRIEKNELSRITPGAFRNL-GSLRYLSLANNKLQVLPIGL 126

  Fly   432 -SSLHHLKYLYLTSNQISQLNNLPS-FTE--NLRVLSLSGNNFSMIPVLGLKNYTQLSYLNMGYN 492
             ..|..|:.|.|:|||:.|:.  |: |::  ||:.|.|.||:...||.....:...|:.||:|.|
Human   127 FQGLDSLESLLLSSNQLLQIQ--PAHFSQCSNLKELQLHGNHLEYIPDGAFDHLVGLTKLNLGKN 189

  Fly   493 SITDIPEGIFAVDSWGSNLQTILLRNNKITHLHLGSFAGLEQIQEISLSFNDITIHHPLVFENVS 557
            |:|.|...:|   ....|||.:.|..|::|.:.:|:|.||..:||::|..|.|.:..|.:|.| :
Human   190 SLTHISPRVF---QHLGNLQVLRLYENRLTDIPMGTFDGLVNLQELALQQNQIGLLSPGLFHN-N 250

  Fly   558 RTLKILELS-----------FAVFP--------ARSLESLDPLDALLPLSQLIWLGLDNNNLKQV 603
            ..|:.|.||           |...|        ..||:.|.| ....|:..|..|.|.:|::..:
Human   251 HNLQRLYLSNNHISQLPPSVFMQLPQLNRLTLFGNSLKELSP-GIFGPMPNLRELWLYDNHISSL 314

  Fly   604 SNESFAQMRELSYINLSFNQLKTLPRGLFQSDAHSHLVEIDLSYNGLERLEAQTFHSLGDLQTLN 668
            .:..|:.:|:|..:.||.||:..:..|.|  :..:.|.|:.|..|.|:.|:...|..|.:||.::
Human   315 PDNVFSNLRQLQVLILSRNQISFISPGAF--NGLTELRELSLHTNALQDLDGNVFRMLANLQNIS 377

  Fly   669 LQSNRLRTIARHAFHNLEFLRYLDLSYNRLVNISHGAFTVLPNLAALDLMHNQ-LCS---LSLKS 729
            ||:||||.:..:.|.|:..|..:.|..|:|.|:..|.|..|..|..|.|..|. .|.   |.|::
Human   378 LQNNRLRQLPGNIFANVNGLMAIQLQNNQLENLPLGIFDHLGKLCELRLYDNPWRCDSDILPLRN 442

  Fly   730 FLYVS 734
            :|.::
Human   443 WLLLN 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4168NP_001285953.1 leucine-rich repeat 99..118 CDD:275380
LRR_8 121..181 CDD:290566
LRR_RI 122..350 CDD:238064
leucine-rich repeat 122..146 CDD:275380
leucine-rich repeat 147..170 CDD:275380
leucine-rich repeat 171..194 CDD:275380
leucine-rich repeat 195..214 CDD:275380
leucine-rich repeat 215..236 CDD:275380
LRR_8 265..322 CDD:290566
leucine-rich repeat 266..287 CDD:275380
leucine-rich repeat 288..311 CDD:275380
leucine-rich repeat 312..338 CDD:275380
LRR_RI 315..546 CDD:238064 62/182 (34%)
leucine-rich repeat 339..365 CDD:275380
LRR_8 365..424 CDD:290566 18/56 (32%)
leucine-rich repeat 366..388 CDD:275380 5/20 (25%)
leucine-rich repeat 389..412 CDD:275380 8/22 (36%)
LRR_8 413..470 CDD:290566 24/60 (40%)
leucine-rich repeat 414..436 CDD:275380 9/22 (41%)
leucine-rich repeat 437..459 CDD:275380 9/24 (38%)
leucine-rich repeat 460..483 CDD:275380 7/22 (32%)
LRR_8 482..545 CDD:290566 23/62 (37%)
leucine-rich repeat 484..510 CDD:275380 9/25 (36%)
leucine-rich repeat 511..534 CDD:275380 9/22 (41%)
leucine-rich repeat 535..589 CDD:275380 19/72 (26%)
LRR_RI 588..891 CDD:238064 47/151 (31%)
LRR_8 588..650 CDD:290566 17/61 (28%)
leucine-rich repeat 590..613 CDD:275380 5/22 (23%)
leucine-rich repeat 614..639 CDD:275380 7/24 (29%)
LRR_8 638..698 CDD:290566 21/59 (36%)
leucine-rich repeat 640..663 CDD:275380 8/22 (36%)
leucine-rich repeat 664..687 CDD:275380 10/22 (45%)
LRR_8 688..749 CDD:290566 16/51 (31%)
leucine-rich repeat 688..711 CDD:275380 8/22 (36%)
leucine-rich repeat 712..735 CDD:275380 8/27 (30%)
leucine-rich repeat 740..783 CDD:275380
LRR_8 784..843 CDD:290566
leucine-rich repeat 785..808 CDD:275380
leucine-rich repeat 809..832 CDD:275380
LRR_RI <827..1053 CDD:238064
LRR_8 832..890 CDD:290566
leucine-rich repeat 833..856 CDD:275380
leucine-rich repeat 857..879 CDD:275380
leucine-rich repeat 880..900 CDD:275380
LRR_8 904..963 CDD:290566
leucine-rich repeat 905..928 CDD:275380
leucine-rich repeat 929..952 CDD:275380
leucine-rich repeat 953..977 CDD:275380
leucine-rich repeat 978..1020 CDD:275380
LRR_8 1019..1074 CDD:290566
leucine-rich repeat 1045..1068 CDD:275380
leucine-rich repeat 1069..1090 CDD:275380
leucine-rich repeat 1091..1114 CDD:275380
leucine-rich repeat 1115..1161 CDD:275380
leucine-rich repeat 1162..1190 CDD:275380
LRRC15NP_001128529.2 LRR_8 60..119 CDD:290566 18/56 (32%)
LRR_RI 63..309 CDD:238064 80/253 (32%)
LRR_8 88..167 CDD:290566 32/81 (40%)
leucine-rich repeat 88..108 CDD:275380 8/20 (40%)
leucine-rich repeat 109..156 CDD:275380 18/48 (38%)
leucine-rich repeat 157..180 CDD:275380 7/22 (32%)
LRR_8 180..239 CDD:290566 23/61 (38%)
leucine-rich repeat 181..204 CDD:275380 9/25 (36%)
leucine-rich repeat 205..228 CDD:275380 9/22 (41%)
LRR_8 228..287 CDD:290566 14/59 (24%)
leucine-rich repeat 229..252 CDD:275380 8/23 (35%)
leucine-rich repeat 253..276 CDD:275380 5/22 (23%)
leucine-rich repeat 277..300 CDD:275380 5/23 (22%)
LRR_8 299..359 CDD:290566 17/61 (28%)
LRR_4 299..340 CDD:289563 11/40 (28%)
leucine-rich repeat 301..324 CDD:275380 5/22 (23%)
LRR_4 324..364 CDD:289563 13/41 (32%)
leucine-rich repeat 325..348 CDD:275380 7/24 (29%)
leucine-rich repeat 349..370 CDD:275380 7/20 (35%)
LRR_8 372..430 CDD:290566 21/57 (37%)
leucine-rich repeat 373..393 CDD:275380 9/19 (47%)
leucine-rich repeat 397..418 CDD:275380 7/20 (35%)
TPKR_C2 429..>468 CDD:301599 5/19 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.