DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4168 and LRRC15

DIOPT Version :10

Sequence 1:NP_609740.4 Gene:CG4168 / 34889 FlyBaseID:FBgn0028888 Length:1330 Species:Drosophila melanogaster
Sequence 2:NP_001128529.2 Gene:LRRC15 / 131578 HGNCID:20818 Length:587 Species:Homo sapiens


Alignment Length:395 Identity:124/395 - (31%)
Similarity:198/395 - (50%) Gaps:38/395 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   368 ALNLEQNFVTQLPEAVF-KATGIAHLVLAFNAISRVHPSAFEGLTETLEYLDLERNRLTTVPVAL 431
            :|.:....:|:|.|:.| ..:.:..|.:..|.:||:.|.||..| .:|.||.|..|:|..:|:.|
Human    63 SLQILNTHITELNESPFLNISALIALRIEKNELSRITPGAFRNL-GSLRYLSLANNKLQVLPIGL 126

  Fly   432 -SSLHHLKYLYLTSNQISQLNNLPS-FTE--NLRVLSLSGNNFSMIPVLGLKNYTQLSYLNMGYN 492
             ..|..|:.|.|:|||:.|:.  |: |::  ||:.|.|.||:...||.....:...|:.||:|.|
Human   127 FQGLDSLESLLLSSNQLLQIQ--PAHFSQCSNLKELQLHGNHLEYIPDGAFDHLVGLTKLNLGKN 189

  Fly   493 SITDIPEGIFAVDSWGSNLQTILLRNNKITHLHLGSFAGLEQIQEISLSFNDITIHHPLVFENVS 557
            |:|.|...:|   ....|||.:.|..|::|.:.:|:|.||..:||::|..|.|.:..|.:|.| :
Human   190 SLTHISPRVF---QHLGNLQVLRLYENRLTDIPMGTFDGLVNLQELALQQNQIGLLSPGLFHN-N 250

  Fly   558 RTLKILELS-----------FAVFP--------ARSLESLDPLDALLPLSQLIWLGLDNNNLKQV 603
            ..|:.|.||           |...|        ..||:.|.| ....|:..|..|.|.:|::..:
Human   251 HNLQRLYLSNNHISQLPPSVFMQLPQLNRLTLFGNSLKELSP-GIFGPMPNLRELWLYDNHISSL 314

  Fly   604 SNESFAQMRELSYINLSFNQLKTLPRGLFQSDAHSHLVEIDLSYNGLERLEAQTFHSLGDLQTLN 668
            .:..|:.:|:|..:.||.||:..:..|.|  :..:.|.|:.|..|.|:.|:...|..|.:||.::
Human   315 PDNVFSNLRQLQVLILSRNQISFISPGAF--NGLTELRELSLHTNALQDLDGNVFRMLANLQNIS 377

  Fly   669 LQSNRLRTIARHAFHNLEFLRYLDLSYNRLVNISHGAFTVLPNLAALDLMHNQ-LCS---LSLKS 729
            ||:||||.:..:.|.|:..|..:.|..|:|.|:..|.|..|..|..|.|..|. .|.   |.|::
Human   378 LQNNRLRQLPGNIFANVNGLMAIQLQNNQLENLPLGIFDHLGKLCELRLYDNPWRCDSDILPLRN 442

  Fly   730 FLYVS 734
            :|.::
Human   443 WLLLN 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4168NP_609740.4 PRK15370 <69..>353 CDD:185268
leucine-rich repeat 99..118 CDD:275380
leucine-rich repeat 122..146 CDD:275380
leucine-rich repeat 147..170 CDD:275380
leucine-rich repeat 171..194 CDD:275380
leucine-rich repeat 195..214 CDD:275380
leucine-rich repeat 215..236 CDD:275380
leucine-rich repeat 266..287 CDD:275380
leucine-rich repeat 288..311 CDD:275380
leucine-rich repeat 312..338 CDD:275380
LRR <338..651 CDD:443914 94/306 (31%)
leucine-rich repeat 339..365 CDD:275380
leucine-rich repeat 366..388 CDD:275380 5/20 (25%)
leucine-rich repeat 389..412 CDD:275380 8/22 (36%)
leucine-rich repeat 414..436 CDD:275380 9/22 (41%)
leucine-rich repeat 437..459 CDD:275380 9/24 (38%)
leucine-rich repeat 460..483 CDD:275380 7/22 (32%)
leucine-rich repeat 484..510 CDD:275380 9/25 (36%)
leucine-rich repeat 511..534 CDD:275380 9/22 (41%)
leucine-rich repeat 535..589 CDD:275380 19/72 (26%)
LRR 543..971 CDD:443914 63/215 (29%)
leucine-rich repeat 590..613 CDD:275380 5/22 (23%)
leucine-rich repeat 614..639 CDD:275380 7/24 (29%)
leucine-rich repeat 640..663 CDD:275380 8/22 (36%)
leucine-rich repeat 664..687 CDD:275380 10/22 (45%)
leucine-rich repeat 688..711 CDD:275380 8/22 (36%)
leucine-rich repeat 712..735 CDD:275380 8/27 (30%)
leucine-rich repeat 740..783 CDD:275380
leucine-rich repeat 785..808 CDD:275380
leucine-rich repeat 809..832 CDD:275380
leucine-rich repeat 833..856 CDD:275380
leucine-rich repeat 857..879 CDD:275380
leucine-rich repeat 880..900 CDD:275380
leucine-rich repeat 905..928 CDD:275380
LRR 911..>1203 CDD:443914
leucine-rich repeat 929..952 CDD:275380
leucine-rich repeat 953..977 CDD:275380
leucine-rich repeat 978..1020 CDD:275380
leucine-rich repeat 1045..1068 CDD:275380
leucine-rich repeat 1069..1090 CDD:275380
leucine-rich repeat 1091..1114 CDD:275380
leucine-rich repeat 1115..1161 CDD:275380
leucine-rich repeat 1162..1190 CDD:275380
PCC 1230..>1298 CDD:188093
LRRC15NP_001128529.2 LRR 50..449 CDD:443914 124/395 (31%)
leucine-rich repeat 88..108 CDD:275380 8/20 (40%)
leucine-rich repeat 109..156 CDD:275380 18/48 (38%)
leucine-rich repeat 157..180 CDD:275380 7/22 (32%)
leucine-rich repeat 181..204 CDD:275380 9/25 (36%)
leucine-rich repeat 205..228 CDD:275380 9/22 (41%)
leucine-rich repeat 229..252 CDD:275380 8/23 (35%)
leucine-rich repeat 253..276 CDD:275380 5/22 (23%)
leucine-rich repeat 277..300 CDD:275380 5/23 (22%)
leucine-rich repeat 301..324 CDD:275380 5/22 (23%)
leucine-rich repeat 325..348 CDD:275380 7/24 (29%)
leucine-rich repeat 349..370 CDD:275380 7/20 (35%)
leucine-rich repeat 373..393 CDD:275380 9/19 (47%)
leucine-rich repeat 397..418 CDD:275380 7/20 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.