DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15269 and ZSCAN12

DIOPT Version :9

Sequence 1:NP_609739.2 Gene:CG15269 / 34887 FlyBaseID:FBgn0028878 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_001156863.1 Gene:ZSCAN12 / 9753 HGNCID:13172 Length:611 Species:Homo sapiens


Alignment Length:274 Identity:101/274 - (36%)
Similarity:130/274 - (47%) Gaps:43/274 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   295 EISYKCRICEKVFGCSETLQAHEKTHKSPR-YECADCGKGFSQLRNYKYHLSVHRGTKEFAA--- 355
            |..|||..|.|.||....|..|::.|...: |.|.||||.|||.....:|:.:|...|.:..   
Human   327 EKPYKCNECGKAFGRWSALNQHQRLHTGEKHYHCNDCGKAFSQKAGLFHHIKIHTRDKPYQCTQC 391

  Fly   356 -----------------------ECPECGKTFNDKGYLSSHLKIHRNRKEYECPYCPKSFNQRVA 397
                                   ||.||||.|.....|.||.:||...|.|:|..|.|||:|. .
Human   392 NKSFSRRSILTQHQGVHTGAKPYECNECGKAFVYNSSLVSHQEIHHKEKCYQCKECGKSFSQS-G 455

  Fly   398 FNMHVRIHTGVKPHKCNECGKRFSRKMLLKQHMRTHSGEKPYQCSVCGKSFADRSNMTLHHRLHS 462
            ...|.|||||.||:||:.|.|.|.::..|.:|.|.|:||:||:|..|||:|..||.:|.|.|:|:
Human   456 LIQHQRIHTGEKPYKCDVCEKAFIQRTSLTEHQRIHTGERPYKCDKCGKAFTQRSVLTEHQRIHT 520

  Fly   463 GIKPFSCPLCPKAFTKKHHLKTHLNYHTGCKPYVCPHPNCNQAFTQSSNMRTH-----------A 516
            |.:|:.|..|..||.....|..|...|||.|||.|  ..|.:||.|.|::..|           .
Human   521 GERPYKCDECGNAFRGITSLIQHQRIHTGEKPYQC--DECGKAFRQRSDLSKHQRIHNRRGTYVC 583

  Fly   517 KKC--QYRPLDGLT 528
            |:|  .:|....||
Human   584 KECGKSFRQNSALT 597

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15269NP_609739.2 C2H2 Zn finger 300..320 CDD:275368 7/19 (37%)
COG5048 <316..502 CDD:227381 81/212 (38%)
C2H2 Zn finger 327..347 CDD:275368 9/19 (47%)
zf-C2H2 356..377 CDD:278523 10/20 (50%)
C2H2 Zn finger 357..377 CDD:275368 9/19 (47%)
zf-H2C2_2 369..394 CDD:290200 12/24 (50%)
C2H2 Zn finger 385..405 CDD:275368 8/19 (42%)
zf-H2C2_2 397..422 CDD:290200 13/24 (54%)
C2H2 Zn finger 413..433 CDD:275368 7/19 (37%)
zf-H2C2_2 426..449 CDD:290200 12/22 (55%)
zf-C2H2 439..461 CDD:278523 11/21 (52%)
C2H2 Zn finger 441..461 CDD:275368 10/19 (53%)
zf-C2H2 467..489 CDD:278523 6/21 (29%)
C2H2 Zn finger 469..489 CDD:275368 6/19 (32%)
C2H2 Zn finger 497..515 CDD:275368 6/17 (35%)
ZSCAN12NP_001156863.1 SCAN 42..152 CDD:128708
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 154..175
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 198..264
C2H2 Zn finger 248..268 CDD:275368
C2H2 Zn finger 276..296 CDD:275368
COG5048 299..579 CDD:227381 96/254 (38%)
C2H2 Zn finger 304..324 CDD:275368
C2H2 Zn finger 332..352 CDD:275368 7/19 (37%)
C2H2 Zn finger 360..380 CDD:275368 9/19 (47%)
C2H2 Zn finger 388..408 CDD:275368 0/19 (0%)
C2H2 Zn finger 416..436 CDD:275368 9/19 (47%)
C2H2 Zn finger 444..463 CDD:275368 8/19 (42%)
C2H2 Zn finger 471..491 CDD:275368 7/19 (37%)
C2H2 Zn finger 499..519 CDD:275368 10/19 (53%)
C2H2 Zn finger 527..547 CDD:275368 6/19 (32%)
C2H2 Zn finger 555..575 CDD:275368 7/21 (33%)
C2H2 Zn finger 583..603 CDD:275368 5/15 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.