DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15269 and ZNF195

DIOPT Version :9

Sequence 1:NP_609739.2 Gene:CG15269 / 34887 FlyBaseID:FBgn0028878 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_001123992.1 Gene:ZNF195 / 7748 HGNCID:12986 Length:629 Species:Homo sapiens


Alignment Length:219 Identity:87/219 - (39%)
Similarity:121/219 - (55%) Gaps:5/219 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   298 YKCRICEKVFGCSETLQAHEKTHKSPR-YECADCGKGFSQLRNYKYHLSVHRGTKEFAAECPECG 361
            :||..|:.:|.....|..|::.|...: |:|.:|||.::|..:...|..:|.|.|.:  :|.|||
Human   410 FKCEECDSIFKWFSDLTKHKRIHTGEKPYKCDECGKAYTQSSHLSEHRRIHTGEKPY--QCEECG 472

  Fly   362 KTFNDKGYLSSHLKIHRNRKEYECPYCPKSFNQRVAFNMHVRIHTGVKPHKCNECGKRFSRKMLL 426
            |.|.....||:|.:.|...|.|.|..|...|.|......|.:.|||.||:||:||||.|::...|
Human   473 KVFRTCSSLSNHKRTHSEEKPYTCEECGNIFKQLSDLTKHKKTHTGEKPYKCDECGKNFTQSSNL 537

  Fly   427 KQHMRTHSGEKPYQCSVCGKSFADRSNMTLHHRLHSGIKPFSCPLCPKAFTKKHHLKTHLNYHTG 491
            ..|.|.|:|||||:|..||:.|...|::|.|.:.|:|.||:.|..|.|.||:..:|..|...|||
Human   538 IVHKRIHTGEKPYKCEECGRVFMWFSDITKHKKTHTGEKPYKCDECGKNFTQSSNLIVHKRIHTG 602

  Fly   492 CKPYVCPHPNCNQAFTQSSNMRTH 515
            .|||.|  ..|.:||||.|::..|
Human   603 EKPYKC--EKCGKAFTQFSHLTVH 624

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15269NP_609739.2 C2H2 Zn finger 300..320 CDD:275368 5/19 (26%)
COG5048 <316..502 CDD:227381 75/186 (40%)
C2H2 Zn finger 327..347 CDD:275368 6/19 (32%)
zf-C2H2 356..377 CDD:278523 9/20 (45%)
C2H2 Zn finger 357..377 CDD:275368 9/19 (47%)
zf-H2C2_2 369..394 CDD:290200 9/24 (38%)
C2H2 Zn finger 385..405 CDD:275368 5/19 (26%)
zf-H2C2_2 397..422 CDD:290200 13/24 (54%)
C2H2 Zn finger 413..433 CDD:275368 9/19 (47%)
zf-H2C2_2 426..449 CDD:290200 12/22 (55%)
zf-C2H2 439..461 CDD:278523 8/21 (38%)
C2H2 Zn finger 441..461 CDD:275368 7/19 (37%)
zf-C2H2 467..489 CDD:278523 7/21 (33%)
C2H2 Zn finger 469..489 CDD:275368 7/19 (37%)
C2H2 Zn finger 497..515 CDD:275368 7/17 (41%)
ZNF195NP_001123992.1 KRAB 4..64 CDD:214630
KRAB 4..43 CDD:279668
Spacer 76..243
COG5048 225..629 CDD:227381 87/219 (40%)
C2H2 Zn finger 246..266 CDD:275368
C2H2 Zn finger 274..294 CDD:275368
C2H2 Zn finger 302..345 CDD:275368
C2H2 Zn finger 384..404 CDD:275368
C2H2 Zn finger 412..432 CDD:275368 5/19 (26%)
zf-H2C2_2 424..449 CDD:290200 8/24 (33%)
C2H2 Zn finger 440..460 CDD:275368 6/19 (32%)
zf-H2C2_2 452..477 CDD:290200 10/26 (38%)
C2H2 Zn finger 468..488 CDD:275368 9/19 (47%)
zf-H2C2_2 480..505 CDD:290200 9/24 (38%)
C2H2 Zn finger 496..516 CDD:275368 5/19 (26%)
zf-H2C2_2 508..533 CDD:290200 13/24 (54%)
C2H2 Zn finger 524..544 CDD:275368 9/19 (47%)
zf-H2C2_2 536..559 CDD:290200 12/22 (55%)
C2H2 Zn finger 552..572 CDD:275368 7/19 (37%)
zf-H2C2_2 567..589 CDD:290200 9/21 (43%)
C2H2 Zn finger 580..600 CDD:275368 7/19 (37%)
zf-H2C2_2 592..617 CDD:290200 12/26 (46%)
C2H2 Zn finger 608..628 CDD:275368 8/19 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24384
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.