DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15269 and ZNF154

DIOPT Version :9

Sequence 1:NP_609739.2 Gene:CG15269 / 34887 FlyBaseID:FBgn0028878 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_001078853.1 Gene:ZNF154 / 7710 HGNCID:12939 Length:437 Species:Homo sapiens


Alignment Length:298 Identity:109/298 - (36%)
Similarity:155/298 - (52%) Gaps:20/298 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   265 KMTGGLITTA------VGSNSGAIGG---IGGYNATSAEEISYKCRICEKVFGCSETLQAHEKTH 320
            |..||.|:..      .|.::.|..|   :.....|...|..|.|..|.|.|..|.:|..|.:.|
Human   119 KSDGGAISHRGKTHYNCGEHTKAFSGKHTLVQQQRTLTTERCYICSECGKSFSKSYSLNDHWRLH 183

  Fly   321 KSPR-YECADCGKGFSQLRNYKYHLSVHRGTKEFAAECPECGKTFNDKGYLSSHLKIHRNRKEYE 384
            ...: |||.:|||.|.|..:...|..||...:..  ||.||||.|::|..|..|.::|...:.||
Human   184 TGEKPYECRECGKSFRQSSSLIQHRRVHTAVRPH--ECDECGKLFSNKSNLIKHRRVHTGERPYE 246

  Fly   385 CPYCPKSFNQRVAFNMHVRIHTGVKPHKCNECGKRFSRKMLLKQHMRTHSGEKPYQCSVCGKSFA 449
            |..|.|||:||.|...|..:|||.:|::|:||||.|:....|.:|.:.|||.:||:||.|||||:
Human   247 CSECGKSFSQRSALLQHRGVHTGERPYECSECGKFFTYHSSLIKHQKVHSGSRPYECSECGKSFS 311

  Fly   450 DRSNMTLHHRLHSGIKPFSCPLCPKAFTKKHHLKTHLNYHTGCKPYVCPHPNCNQAFTQSSNMRT 514
            ..|::..|||:|:|.:|:.|..|.|:|:::..|..|...|||.:||.|  ..|.:.|..||::|.
Human   312 QNSSLIEHHRVHTGERPYKCSECGKSFSQRSALLQHRGVHTGERPYEC--SECGKFFPYSSSLRK 374

  Fly   515 HAK-KCQYRPLD----GLTVT-SSALPVPGKQQTGPPP 546
            |.: ....||.:    |.:.| :|.|....:..||..|
Human   375 HQRVHTGSRPYECSECGKSFTQNSGLIKHRRVHTGEKP 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15269NP_609739.2 C2H2 Zn finger 300..320 CDD:275368 7/19 (37%)
COG5048 <316..502 CDD:227381 78/186 (42%)
C2H2 Zn finger 327..347 CDD:275368 7/19 (37%)
zf-C2H2 356..377 CDD:278523 10/20 (50%)
C2H2 Zn finger 357..377 CDD:275368 9/19 (47%)
zf-H2C2_2 369..394 CDD:290200 10/24 (42%)
C2H2 Zn finger 385..405 CDD:275368 9/19 (47%)
zf-H2C2_2 397..422 CDD:290200 12/24 (50%)
C2H2 Zn finger 413..433 CDD:275368 8/19 (42%)
zf-H2C2_2 426..449 CDD:290200 13/22 (59%)
zf-C2H2 439..461 CDD:278523 12/21 (57%)
C2H2 Zn finger 441..461 CDD:275368 11/19 (58%)
zf-C2H2 467..489 CDD:278523 6/21 (29%)
C2H2 Zn finger 469..489 CDD:275368 6/19 (32%)
C2H2 Zn finger 497..515 CDD:275368 6/17 (35%)
ZNF154NP_001078853.1 KRAB 14..>62 CDD:214630
KRAB 14..53 CDD:279668
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 110..129 4/9 (44%)
C2H2 Zn finger 135..155 CDD:275368 3/19 (16%)
COG5048 139..>436 CDD:227381 104/278 (37%)
C2H2 Zn finger 163..183 CDD:275368 7/19 (37%)
C2H2 Zn finger 191..211 CDD:275368 7/19 (37%)
C2H2 Zn finger 219..239 CDD:275368 9/19 (47%)
zf-H2C2_2 231..256 CDD:290200 10/24 (42%)
C2H2 Zn finger 247..267 CDD:275368 9/19 (47%)
C2H2 Zn finger 275..295 CDD:275368 8/19 (42%)
zf-H2C2_2 287..312 CDD:290200 14/24 (58%)
C2H2 Zn finger 303..323 CDD:275368 11/19 (58%)
zf-H2C2_2 315..340 CDD:290200 10/24 (42%)
C2H2 Zn finger 331..351 CDD:275368 6/19 (32%)
C2H2 Zn finger 359..379 CDD:275368 7/21 (33%)
zf-H2C2_2 371..396 CDD:290200 5/24 (21%)
C2H2 Zn finger 387..407 CDD:275368 4/19 (21%)
zf-H2C2_2 400..424 CDD:290200 4/13 (31%)
C2H2 Zn finger 415..435 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.