DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15269 and ZNF141

DIOPT Version :9

Sequence 1:NP_609739.2 Gene:CG15269 / 34887 FlyBaseID:FBgn0028878 Length:587 Species:Drosophila melanogaster
Sequence 2:XP_016864080.1 Gene:ZNF141 / 7700 HGNCID:12926 Length:534 Species:Homo sapiens


Alignment Length:470 Identity:132/470 - (28%)
Similarity:188/470 - (40%) Gaps:95/470 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 PDLVAMANATKFYAQFFPHLLPAYAAAAAAAGLSTPPTSPYQTHQHQQHLPNQQKRFFAPYVING 159
            ||||......|     .|:.:..:...|      .||.  ..:|..|.|.|.|            
Human   110 PDLVTCLEQRK-----EPYNVKIHKIVA------RPPA--MCSHFTQDHWPVQ------------ 149

  Fly   160 SVPPPPPLQQQQQPLIRTKSTAC------TRPDCP---ECLDYYQRLQTGGYKQTAPLISPAASS 215
                  .::.....||..:...|      .|..|.   ||     :||.|||.:....:|...|.
Human   150 ------GIEDSFHKLILRRYEKCGHDNLQLRKGCKSLNEC-----KLQKGGYNEFNECLSTTQSK 203

  Fly   216 VSSSTGSIRPVRDLIMS------ATG-------GAASTNISLTT--------------------- 246
            :.....|::.|.....|      .||       |.:....|..|                     
Human   204 ILQCKASVKVVSKFSNSNKRKTRHTGEKHFKECGKSFQKFSHLTQHKVIHAGEKPYTCEECGKAF 268

  Fly   247 VTNLSLNSVQATAVGMMP---KMTGGLITTAVGSNSGAIGGIGGYNATSAEEISYKCRICEKVFG 308
            ..:|..|..:....|..|   :..|.:.||:        .....:......|..|||..|.|.|.
Human   269 KWSLIFNEHKRIHTGEKPFTCEECGSIFTTS--------SHFAKHKIIHTGEKPYKCEECGKAFN 325

  Fly   309 CSETLQAHEKTHKSPR-YECADCGKGFSQLRNYKYHLSVHRGTKEFAAECPECGKTFNDKGYLSS 372
            ...||..|::.|...: ..|.:|.|.|:...|:..|..:|.|.|.:  :|.||||.||....|:.
Human   326 RFTTLTKHKRIHAGEKPITCEECRKIFTSSSNFAKHKRIHTGEKPY--KCEECGKAFNRSTTLTK 388

  Fly   373 HLKIHRNRKEYECPYCPKSFNQRVAFNMHVRIHTGVKPHKCNECGKRFSRKMLLKQHMRTHSGEK 437
            |.:||...|.|.|..|.|:|.|....|.|.::|||.:|:||:||||.|.|..:|.:|.:.|:|||
Human   389 HKRIHTGEKPYTCEECGKAFRQSSKLNEHKKVHTGERPYKCDECGKAFGRSRVLNEHKKIHTGEK 453

  Fly   438 PYQCSVCGKSFADRSNMTLHHRLHSGIKPFSCPLCPKAFTKKHHLKTHLNYHTGCKPYVCPHPNC 502
            ||:|..|||:|...::.:.|.::||..||:.|..|.|||.:...|..|...||..|||.|  .:|
Human   454 PYKCEECGKAFRRSTDRSQHKKIHSADKPYKCKECDKAFKQFSLLSQHKKIHTVDKPYKC--KDC 516

  Fly   503 NQAFTQSSNMRTHAK 517
            ::||.:.|::..|.|
Human   517 DKAFKRFSHLNKHKK 531

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15269NP_609739.2 C2H2 Zn finger 300..320 CDD:275368 7/19 (37%)
COG5048 <316..502 CDD:227381 74/186 (40%)
C2H2 Zn finger 327..347 CDD:275368 6/19 (32%)
zf-C2H2 356..377 CDD:278523 9/20 (45%)
C2H2 Zn finger 357..377 CDD:275368 9/19 (47%)
zf-H2C2_2 369..394 CDD:290200 10/24 (42%)
C2H2 Zn finger 385..405 CDD:275368 7/19 (37%)
zf-H2C2_2 397..422 CDD:290200 13/24 (54%)
C2H2 Zn finger 413..433 CDD:275368 9/19 (47%)
zf-H2C2_2 426..449 CDD:290200 12/22 (55%)
zf-C2H2 439..461 CDD:278523 7/21 (33%)
C2H2 Zn finger 441..461 CDD:275368 6/19 (32%)
zf-C2H2 467..489 CDD:278523 7/21 (33%)
C2H2 Zn finger 469..489 CDD:275368 7/19 (37%)
C2H2 Zn finger 497..515 CDD:275368 5/17 (29%)
ZNF141XP_016864080.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24384
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.