DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15269 and Zfp998

DIOPT Version :9

Sequence 1:NP_609739.2 Gene:CG15269 / 34887 FlyBaseID:FBgn0028878 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_001277125.1 Gene:Zfp998 / 76803 MGIID:1924053 Length:464 Species:Mus musculus


Alignment Length:231 Identity:98/231 - (42%)
Similarity:132/231 - (57%) Gaps:5/231 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   288 YNATSAEEISYKCRICEKVFGCSETLQAHEKTHKSPR-YECADCGKGFSQLRNYKYHLSVHRGTK 351
            :..|...|..|:|..|.|.|.....||.|::||...: |||..|||.||.....:||...|.|.|
Mouse   177 HKRTHTGEKPYECNQCGKAFARPANLQCHKRTHTGEKPYECNQCGKAFSCQGGLRYHKRTHTGEK 241

  Fly   352 EFAAECPECGKTFNDKGYLSSHLKIHRNRKEYECPYCPKSFNQRVAFNMHVRIHTGVKPHKCNEC 416
            .:  ||.:|||.|....:|..|.:.|...|.|||..|.|:|:..::...|.|.|||.||::||:|
Mouse   242 PY--ECNQCGKAFARPSHLQCHKRTHTGEKPYECNQCGKAFSSHISLRYHKRTHTGEKPYECNQC 304

  Fly   417 GKRFSRKMLLKQHMRTHSGEKPYQCSVCGKSFADRSNMTLHHRLHSGIKPFSCPLCPKAFTKKHH 481
            ||.||....|:.|.|||:|||||:|:.|||:||..|::..|.|.|:|.||:.|..|.|||.:..|
Mouse   305 GKAFSGHSGLRYHKRTHTGEKPYECNQCGKAFATPSHLQCHKRTHTGEKPYECNQCSKAFARPAH 369

  Fly   482 LKTHLNYHTGCKPYVCPHPNCNQAFTQSSNMRTHAK 517
            |:.|...|||.|||.|  ..|.:||.:.|:::.|.:
Mouse   370 LQHHKRTHTGEKPYEC--NQCGKAFARLSHLQCHKR 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15269NP_609739.2 C2H2 Zn finger 300..320 CDD:275368 7/19 (37%)
COG5048 <316..502 CDD:227381 84/186 (45%)
C2H2 Zn finger 327..347 CDD:275368 8/19 (42%)
zf-C2H2 356..377 CDD:278523 8/20 (40%)
C2H2 Zn finger 357..377 CDD:275368 7/19 (37%)
zf-H2C2_2 369..394 CDD:290200 10/24 (42%)
C2H2 Zn finger 385..405 CDD:275368 6/19 (32%)
zf-H2C2_2 397..422 CDD:290200 13/24 (54%)
C2H2 Zn finger 413..433 CDD:275368 10/19 (53%)
zf-H2C2_2 426..449 CDD:290200 14/22 (64%)
zf-C2H2 439..461 CDD:278523 10/21 (48%)
C2H2 Zn finger 441..461 CDD:275368 9/19 (47%)
zf-C2H2 467..489 CDD:278523 8/21 (38%)
C2H2 Zn finger 469..489 CDD:275368 8/19 (42%)
C2H2 Zn finger 497..515 CDD:275368 5/17 (29%)
Zfp998NP_001277125.1 KRAB 4..>46 CDD:214630
KRAB 4..43 CDD:279668
COG5048 72..452 CDD:227381 98/231 (42%)
C2H2 Zn finger 77..97 CDD:275368
zf-H2C2_2 89..114 CDD:290200
C2H2 Zn finger 105..125 CDD:275368
zf-H2C2_2 117..142 CDD:290200
C2H2 Zn finger 133..153 CDD:275368
zf-H2C2_2 146..170 CDD:290200
C2H2 Zn finger 161..181 CDD:275368 0/3 (0%)
zf-H2C2_2 173..198 CDD:290200 7/20 (35%)
C2H2 Zn finger 189..209 CDD:275368 7/19 (37%)
zf-H2C2_2 201..226 CDD:290200 12/24 (50%)
C2H2 Zn finger 217..237 CDD:275368 8/19 (42%)
zf-H2C2_2 230..254 CDD:290200 11/25 (44%)
C2H2 Zn finger 245..265 CDD:275368 7/19 (37%)
zf-H2C2_2 257..282 CDD:290200 10/24 (42%)
C2H2 Zn finger 273..293 CDD:275368 6/19 (32%)
zf-H2C2_2 285..309 CDD:290200 12/23 (52%)
C2H2 Zn finger 301..321 CDD:275368 10/19 (53%)
zf-H2C2_2 314..338 CDD:290200 15/23 (65%)
C2H2 Zn finger 329..349 CDD:275368 9/19 (47%)
zf-H2C2_2 341..366 CDD:290200 11/24 (46%)
C2H2 Zn finger 357..377 CDD:275368 8/19 (42%)
zf-H2C2_2 369..394 CDD:290200 13/26 (50%)
C2H2 Zn finger 385..405 CDD:275368 6/21 (29%)
zf-H2C2_2 397..422 CDD:290200 1/7 (14%)
C2H2 Zn finger 413..433 CDD:275368
C2H2 Zn finger 441..461 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.