DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15269 and ZNF736

DIOPT Version :9

Sequence 1:NP_609739.2 Gene:CG15269 / 34887 FlyBaseID:FBgn0028878 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_001164376.1 Gene:ZNF736 / 728927 HGNCID:32467 Length:427 Species:Homo sapiens


Alignment Length:389 Identity:117/389 - (30%)
Similarity:162/389 - (41%) Gaps:72/389 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 LQQQQQPLIR-----------TKSTACTRPDCPECLDYYQRLQTGGYK-QTAPLISPAASSVSSS 219
            |...||.|.|           :...|..:||...||:  ||.:....| |.|....||.|  ...
Human    21 LDSAQQRLYRDVMLENYGNLVSLGLAIFKPDLMTCLE--QRKEPWKVKRQEAVAKHPAGS--FHF 81

  Fly   220 TGSIRPVRDL------IMSATGGAASTNISLTTVTNLSLNSVQATAVGMMPKMTGGLITTAVGSN 278
            |..|.|..|:      ::....|:...|       ||.|....                .:||:.
Human    82 TAEILPDHDIKDSFQKVILRKYGSCDLN-------NLHLKKDY----------------QSVGNC 123

  Fly   279 SGAIGGIGGYNATSAEEISYKCRICEK---------VFGCSETLQAHEKTHKSPRYECADCGKGF 334
            .|......|.:...:...|..|: |.|         :|...:.:.:.||.||     |.:|||..
Human   124 KGQKSSYNGLHQCLSATHSKTCQ-CNKCGRGFQLCSIFTEHKDIFSREKCHK-----CEECGKDC 182

  Fly   335 SQLRNYKYHLSVHRGTKEFAAECPECGKTFNDKGYLSSHLKIHRNRKEYECPYCPKSFNQRVAFN 399
            ....::..|..:|  |.|...:|.||||.|.....|:.|.::|...|.|:|..|.|:|.......
Human   183 RLFSDFTRHKKIH--TVERCYKCEECGKAFKKFSNLTEHKRVHTGEKPYKCEGCGKTFTCSSTLV 245

  Fly   400 MHVRIHTGVKPHKCNECGKRFSRKMLLKQHMRTHSGEKPYQCSVCGKSFADRSNMTLHHRLHSGI 464
            .|.|.|||.:|:||.||||.|.....|..|.|.|:|||||:|..|.|::...|::..|..:|:|.
Human   246 KHKRNHTGDRPYKCEECGKAFKCFSDLTNHKRIHTGEKPYKCEECNKAYRWFSDLAKHKIIHTGD 310

  Fly   465 KPFSCPLCPKAFTKKHHLKTHLNYHTGCKPYVCPHPNCNQAFTQSSNMRTHAK--------KCQ 520
            ||::|..|.|||.....|..|...|||.|||:|  ..|.:|||:||.:..|.:        ||:
Human   311 KPYTCNECGKAFKWFSALSKHKRIHTGEKPYIC--EECGKAFTRSSTLFNHKRIHMEERPYKCE 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15269NP_609739.2 C2H2 Zn finger 300..320 CDD:275368 6/28 (21%)
COG5048 <316..502 CDD:227381 72/185 (39%)
C2H2 Zn finger 327..347 CDD:275368 5/19 (26%)
zf-C2H2 356..377 CDD:278523 8/20 (40%)
C2H2 Zn finger 357..377 CDD:275368 8/19 (42%)
zf-H2C2_2 369..394 CDD:290200 9/24 (38%)
C2H2 Zn finger 385..405 CDD:275368 6/19 (32%)
zf-H2C2_2 397..422 CDD:290200 13/24 (54%)
C2H2 Zn finger 413..433 CDD:275368 9/19 (47%)
zf-H2C2_2 426..449 CDD:290200 12/22 (55%)
zf-C2H2 439..461 CDD:278523 6/21 (29%)
C2H2 Zn finger 441..461 CDD:275368 5/19 (26%)
zf-C2H2 467..489 CDD:278523 7/21 (33%)
C2H2 Zn finger 469..489 CDD:275368 7/19 (37%)
C2H2 Zn finger 497..515 CDD:275368 7/17 (41%)
ZNF736NP_001164376.1 KRAB 4..63 CDD:214630 12/43 (28%)
KRAB 4..43 CDD:279668 5/21 (24%)
C2H2 Zn finger 147..167 CDD:275368 3/19 (16%)
C2H2 Zn finger 175..195 CDD:275368 5/19 (26%)
C2H2 Zn finger 203..223 CDD:275368 8/19 (42%)
zf-H2C2_2 215..240 CDD:290200 9/24 (38%)
COG5048 <227..383 CDD:227381 60/148 (41%)
C2H2 Zn finger 231..251 CDD:275368 6/19 (32%)
zf-H2C2_2 244..268 CDD:290200 13/23 (57%)
C2H2 Zn finger 259..279 CDD:275368 9/19 (47%)
zf-H2C2_2 271..294 CDD:290200 12/22 (55%)
C2H2 Zn finger 287..307 CDD:275368 5/19 (26%)
C2H2 Zn finger 315..335 CDD:275368 7/19 (37%)
zf-H2C2_2 327..352 CDD:290200 12/26 (46%)
C2H2 Zn finger 343..363 CDD:275368 8/21 (38%)
C2H2 Zn finger 371..391 CDD:275368 1/2 (50%)
zf-H2C2_2 383..407 CDD:290200
C2H2 Zn finger 399..419 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24384
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.