DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG15269 and KLF9

DIOPT Version :9

Sequence 1:	NP_609739.2	Gene:	CG15269 / 34887	FlyBaseID:	FBgn0028878	Length:	587	Species:	Drosophila melanogaster
Sequence 2:	NP_001197.1	Gene:	KLF9 / 687	HGNCID:	1123	Length:	244	Species:	Homo sapiens

Alignment Length:	94	Identity:	39/94 - (41%)
Similarity:	51/94 - (54%)	Gaps:	4/94 - (4%)

- Green bases have known domain annotations that are detailed below.

  Fly   405 HTGVKPHKC--NECGKRFSRKMLLKQHMRTHSGEKPYQCS--VCGKSFADRSNMTLHHRLHSGIK 465
            |...|.|||  :.|||.:.:...||.|.|.|:||:|:.|:  .|.|.|:....:|.|:|.|:|.|
Human   137 HASEKRHKCPYSGCGKVYGKSSHLKAHYRVHTGERPFPCTWPDCLKKFSRSDELTRHYRTHTGEK 201

  Fly   466 PFSCPLCPKAFTKKHHLKTHLNYHTGCKP 494
            .|.||||.|.|.:..||..|...||...|
Human   202 QFRCPLCEKRFMRSDHLTKHARRHTEFHP 230

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG15269	NP_609739.2	C2H2 Zn finger	300..320	CDD:275368
		COG5048	<316..502	CDD:227381	39/94 (41%)
		C2H2 Zn finger	327..347	CDD:275368
		zf-C2H2	356..377	CDD:278523
		C2H2 Zn finger	357..377	CDD:275368
		zf-H2C2_2	369..394	CDD:290200
		C2H2 Zn finger	385..405	CDD:275368	39/94 (41%)
		zf-H2C2_2	397..422	CDD:290200	8/18 (44%)
		C2H2 Zn finger	413..433	CDD:275368	8/21 (38%)
		zf-H2C2_2	426..449	CDD:290200	11/24 (46%)
		zf-C2H2	439..461	CDD:278523	7/23 (30%)
		C2H2 Zn finger	441..461	CDD:275368	7/21 (33%)
		zf-C2H2	467..489	CDD:278523	10/21 (48%)
		C2H2 Zn finger	469..489	CDD:275368	9/19 (47%)
		C2H2 Zn finger	497..515	CDD:275368
KLF9	NP_001197.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	80..142		1/4 (25%)
		COG5048	<94..234	CDD:227381	39/94 (41%)
		C2H2 Zn finger	145..167	CDD:275368	8/21 (38%)
		C2H2 Zn finger	175..197	CDD:275368	7/21 (33%)
		C2H2 Zn finger	205..225	CDD:275368	9/19 (47%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910