Sequence 1: | NP_609739.2 | Gene: | CG15269 / 34887 | FlyBaseID: | FBgn0028878 | Length: | 587 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001077387.1 | Gene: | Zfp991 / 666532 | MGIID: | 3701604 | Length: | 573 | Species: | Mus musculus |
Alignment Length: | 263 | Identity: | 102/263 - (38%) |
---|---|---|---|
Similarity: | 142/263 - (53%) | Gaps: | 15/263 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 293 AEEISYKCRICEKVFGCSETLQAHEKTHKSPR-YECADCGKGFSQLRNYKYHLSVHRGTKEFAAE 356
Fly 357 CPECGKTFNDKGYLSSHLKIHRNRKEYECPYCPKSFNQRVAFNMHVRIHTGVKPHKCNECGKRFS 421
Fly 422 RKMLLKQHMRTHSGEKPYQCSVCGKSFADRSNMTLHHRLHSGIKPFSCPLCPKAFTKKHHLKTHL 486
Fly 487 NYHTGCKPYVCPHPNCNQAFTQSSNMRTHAK--------KCQYRPLDGLTVTSSALPVPGKQQTG 543
Fly 544 PPP 546 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG15269 | NP_609739.2 | C2H2 Zn finger | 300..320 | CDD:275368 | 6/19 (32%) |
COG5048 | <316..502 | CDD:227381 | 80/186 (43%) | ||
C2H2 Zn finger | 327..347 | CDD:275368 | 6/19 (32%) | ||
zf-C2H2 | 356..377 | CDD:278523 | 8/20 (40%) | ||
C2H2 Zn finger | 357..377 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 369..394 | CDD:290200 | 10/24 (42%) | ||
C2H2 Zn finger | 385..405 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 397..422 | CDD:290200 | 14/24 (58%) | ||
C2H2 Zn finger | 413..433 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 426..449 | CDD:290200 | 14/22 (64%) | ||
zf-C2H2 | 439..461 | CDD:278523 | 9/21 (43%) | ||
C2H2 Zn finger | 441..461 | CDD:275368 | 8/19 (42%) | ||
zf-C2H2 | 467..489 | CDD:278523 | 9/21 (43%) | ||
C2H2 Zn finger | 469..489 | CDD:275368 | 9/19 (47%) | ||
C2H2 Zn finger | 497..515 | CDD:275368 | 5/17 (29%) | ||
Zfp991 | NP_001077387.1 | KRAB | 12..52 | CDD:396083 | |
C2H2 Zn finger | 186..206 | CDD:275368 | |||
C2H2 Zn finger | 218..234 | CDD:275368 | |||
C2H2 Zn finger | 242..262 | CDD:275368 | 6/19 (32%) | ||
COG5048 | 266..>550 | CDD:227381 | 90/232 (39%) | ||
C2H2 Zn finger | 270..290 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 298..318 | CDD:275368 | 8/19 (42%) | ||
C2H2 Zn finger | 326..346 | CDD:275368 | 8/19 (42%) | ||
C2H2 Zn finger | 354..374 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 382..402 | CDD:275368 | 8/19 (42%) | ||
C2H2 Zn finger | 410..430 | CDD:275368 | 9/19 (47%) | ||
C2H2 Zn finger | 438..458 | CDD:275368 | 6/21 (29%) | ||
C2H2 Zn finger | 466..486 | CDD:275368 | 3/21 (14%) | ||
C2H2 Zn finger | 494..514 | CDD:275368 | |||
C2H2 Zn finger | 522..542 | CDD:275368 | |||
C2H2 Zn finger | 550..566 | CDD:275368 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |