DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15269 and znf250

DIOPT Version :9

Sequence 1:NP_609739.2 Gene:CG15269 / 34887 FlyBaseID:FBgn0028878 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_001025647.1 Gene:znf250 / 595035 XenbaseID:XB-GENE-6453461 Length:481 Species:Xenopus tropicalis


Alignment Length:447 Identity:111/447 - (24%)
Similarity:162/447 - (36%) Gaps:115/447 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 PHLLPAYAAAAAAAGLSTPPTSPY--------------QTHQHQQHLPNQQKRFFAPYVINGSVP 162
            |..||:...:....|...|..|.:              ....|.:.||:..         ||   
 Frog    94 PETLPSNLKSKDPGGKKKPAKSVHWKDEEMDTNGSGYSHDENHDEQLPSSP---------NG--- 146

  Fly   163 PPPPLQQQQQPLIRTKSTACTRPDCPEC------LDYYQRLQTG-------------GYKQT--- 205
                     :.|.:.|...|  .||.:|      |:.::|:.:|             .||..   
 Frog   147 ---------RSLRKRKQYFC--HDCEKCFKHSSALEAHRRVHSGDKPHQCDICKETFSYKSALIV 200

  Fly   206 -APLISPAASSVSSSTGSIRPVRDLIMSATGGAASTNISLTTVTNLSLN----SVQATAVGMMPK 265
             ..|.|.|::|.|....:.:|..         .|...:...:..|.:|.    |..|.||.....
 Frog   201 HRRLHSQASTSKSQEEENQKPAE---------TAPVVVKPPSPVNTTLENPPVSPTAPAVSASAP 256

  Fly   266 MTGGLITTAVGSNSGAIGGIGGYNATSAEEISYKCRICEKVFGCSETLQAHEKTHKSPRYECADC 330
            :..   |..|.|||..:...|        |..:||..|:|.|.....|:||.:.|          
 Frog   257 VVN---TQVVNSNSTVVNSYG--------EKPHKCNYCDKRFNDLSILEAHHRIH---------- 300

  Fly   331 GKGFSQLRNYKYHLSVHRGTKEFAAECPECGKTFNDKGYLSSHLKIHRNRKEYECPYCPKSFNQR 395
                               |.:.|..|..|.::|:....|::|...|:..|.|:|..|.|:||.:
 Frog   301 -------------------TGKLAYPCTMCDQSFSKPSLLAAHNNTHKEGKPYQCDQCDKNFNDQ 346

  Fly   396 VAFNMHVRIHTGVKPHKCNECGKRFSRKMLLKQHMRTHSGEKPYQCSVCGKSFADRSNMTLHHRL 460
            .....|.|.|||.|||||:.|.|.|..:..|..|...|...|||:|..|.|||.|:|.:..|..:
 Frog   347 SLLVAHKRTHTGEKPHKCSHCNKWFPNRTTLIAHEECHLKPKPYKCKHCEKSFNDKSLLVTHEGV 411

  Fly   461 HSGIKPFSCPLCPKAFTKKHHLKTHLNYHTGCKPYVCPHPNCNQAFTQSSNMRTHAK 517
            |:..|||.|..||::|..|..|..|...|...||:.|  ..|.::|.:...:..|.:
 Frog   412 HTDTKPFKCNQCPESFFLKTQLMVHQATHAPEKPFPC--SQCERSFNKKETLLAHIR 466

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15269NP_609739.2 C2H2 Zn finger 300..320 CDD:275368 7/19 (37%)
COG5048 <316..502 CDD:227381 59/185 (32%)
C2H2 Zn finger 327..347 CDD:275368 0/19 (0%)
zf-C2H2 356..377 CDD:278523 5/20 (25%)
C2H2 Zn finger 357..377 CDD:275368 5/19 (26%)
zf-H2C2_2 369..394 CDD:290200 9/24 (38%)
C2H2 Zn finger 385..405 CDD:275368 7/19 (37%)
zf-H2C2_2 397..422 CDD:290200 13/24 (54%)
C2H2 Zn finger 413..433 CDD:275368 6/19 (32%)
zf-H2C2_2 426..449 CDD:290200 10/22 (45%)
zf-C2H2 439..461 CDD:278523 9/21 (43%)
C2H2 Zn finger 441..461 CDD:275368 8/19 (42%)
zf-C2H2 467..489 CDD:278523 8/21 (38%)
C2H2 Zn finger 469..489 CDD:275368 7/19 (37%)
C2H2 Zn finger 497..515 CDD:275368 3/17 (18%)
znf250NP_001025647.1 KRAB 7..48 CDD:366587
zf-C2H2 155..177 CDD:333835 6/23 (26%)
C2H2 Zn finger 157..177 CDD:275368 6/21 (29%)
C2H2 Zn finger 185..205 CDD:275368 2/19 (11%)
COG5048 <264..408 CDD:227381 55/180 (31%)
C2H2 Zn finger 280..300 CDD:275368 7/19 (37%)
C2H2 Zn finger 308..328 CDD:275368 5/19 (26%)
C2H2 Zn finger 336..356 CDD:275368 7/19 (37%)
C2H2 Zn finger 364..384 CDD:275368 6/19 (32%)
C2H2 Zn finger 392..412 CDD:275368 8/19 (42%)
C2H2 Zn finger 420..440 CDD:275368 7/19 (37%)
C2H2 Zn finger 448..468 CDD:275368 4/21 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004498
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.