| Sequence 1: | NP_609739.2 | Gene: | CG15269 / 34887 | FlyBaseID: | FBgn0028878 | Length: | 587 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_113830.2 | Gene: | Klf6 / 58954 | RGDID: | 62389 | Length: | 317 | Species: | Rattus norvegicus |
| Alignment Length: | 396 | Identity: | 87/396 - (21%) |
|---|---|---|---|
| Similarity: | 128/396 - (32%) | Gaps: | 153/396 - (38%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 159 GSVPPPPPLQQQQQPLIRTKSTACTRPDCPECL-------------------------------- 191
Fly 192 -DYYQR--LQTGGYKQTAPLISPAAS-------------------------SVSSSTGSIRPVRD 228
Fly 229 LIMSATGGAASTNISLTTVTNLSLNSVQATAVGMMPKMTGGLITTAVGS---NSGAIGGIGGYNA 290
Fly 291 TSAEEISYKCRICEKVFGCSETLQAHEKTHKSPRYECADCGKGFSQLRNYKYHLSVHRGTKEFAA 355
Fly 356 ECPECGKTFNDKGYLSSHLKIHRNRKEYECPYCPKSFNQRVAFNMHVRIHTGVKPHKCNECGKRF 420
Fly 421 SRKMLLKQHMRTHSGEKPYQCS--VCGKSFADRSNMTLHHRLHSGIKPFSCPLCPKAFTKKHHLK 483
Fly 484 THLNYH 489 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG15269 | NP_609739.2 | C2H2 Zn finger | 300..320 | CDD:275368 | 3/19 (16%) |
| COG5048 | <316..502 | CDD:227381 | 47/176 (27%) | ||
| C2H2 Zn finger | 327..347 | CDD:275368 | 2/19 (11%) | ||
| zf-C2H2 | 356..377 | CDD:278523 | 6/20 (30%) | ||
| C2H2 Zn finger | 357..377 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 369..394 | CDD:290200 | 3/24 (13%) | ||
| C2H2 Zn finger | 385..405 | CDD:275368 | 1/19 (5%) | ||
| zf-H2C2_2 | 397..422 | CDD:290200 | 3/24 (13%) | ||
| C2H2 Zn finger | 413..433 | CDD:275368 | 7/19 (37%) | ||
| zf-H2C2_2 | 426..449 | CDD:290200 | 14/24 (58%) | ||
| zf-C2H2 | 439..461 | CDD:278523 | 9/23 (39%) | ||
| C2H2 Zn finger | 441..461 | CDD:275368 | 8/21 (38%) | ||
| zf-C2H2 | 467..489 | CDD:278523 | 7/21 (33%) | ||
| C2H2 Zn finger | 469..489 | CDD:275368 | 6/19 (32%) | ||
| C2H2 Zn finger | 497..515 | CDD:275368 | |||
| Klf6 | NP_113830.2 | COG5048 | 211..>299 | CDD:227381 | 38/125 (30%) |
| zf-C2H2 | 234..258 | CDD:278523 | 8/49 (16%) | ||
| C2H2 Zn finger | 239..258 | CDD:275368 | 7/18 (39%) | ||
| zf-H2C2_2 | 250..>266 | CDD:290200 | 11/15 (73%) | ||
| C2H2 Zn finger | 266..288 | CDD:275368 | 8/21 (38%) | ||
| zf-H2C2_2 | 280..305 | CDD:290200 | 11/24 (46%) | ||
| C2H2 Zn finger | 296..316 | CDD:275368 | 6/19 (32%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||