DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15269 and ZBTB2

DIOPT Version :9

Sequence 1:NP_609739.2 Gene:CG15269 / 34887 FlyBaseID:FBgn0028878 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_065912.1 Gene:ZBTB2 / 57621 HGNCID:20868 Length:514 Species:Homo sapiens


Alignment Length:433 Identity:92/433 - (21%)
Similarity:143/433 - (33%) Gaps:152/433 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 APYVINGSVPPPPPLQQ-----QQQPLIRTKSTAC----TRPDCPECLDYYQRLQTGGYKQTAPL 208
            ||.:|:     |..|:|     ...|||:..|.|.    :.||                 |..||
Human    86 APQLID-----PVRLEQGIKFLHAYPLIQEASLASQGAFSHPD-----------------QVFPL 128

  Fly   209 ISP------------AASSVSSSTGSI----RPVRDLIMSATGGAASTNISLTTVTNLSLNSVQA 257
            .|.            .|:.::|:...:    ||....|.......||      .::.|:.|..|.
Human   129 ASSLYGIQIADHQLRQATKIASAPEKLGRDPRPQTSRISQEQVPEAS------QLSQLTSNLAQV 187

  Fly   258 TAVGMMP------KMTGGLITTAV-----GSNSGAIGGIGGYNATSAEEISYKCRICEKVFGCSE 311
            ....|.|      .::..|::|.|     |..:       ...|:|::|......|         
Human   188 NRTNMTPSDPLQTSLSPELVSTPVPPPPPGEET-------NLEASSSDEQPASLTI--------- 236

  Fly   312 TLQAHEKTHKSPR-------YECADCGKGFSQLRNYKYHLSVHRGTK------------------ 351
               ||.|.....|       |.|..||:.|:...:.:.||.:|.|..                  
Human   237 ---AHVKPSIMKRNGSFPKYYACHLCGRRFTLRSSLREHLQIHTGVPFTSSQQGESRVPLTLCSN 298

  Fly   352 -----EFAAECPECG-------KTFNDKGYLSSHLKIHR---------------------NRKEY 383
                 :.|.|.||.|       :..:|...:....:...                     .|::|
Human   299 AADLGKDAMEVPEAGMISDSELQHISDSPIIDGQQQSETPPPSDIADIDNLEQADQEREVKRRKY 363

  Fly   384 ECPYCPKSFNQRVAFNMHVRIHTGVKPHKCNECGKRF------SRKMLLKQHMRTHSGEKPYQCS 442
            ||..|.:.|.|:..:..|:.|||| ||.||:.|.|.|      :|.:.|.|.:.|::........
Human   364 ECTICGRKFIQKSHWREHMYIHTG-KPFKCSTCDKSFCRANQAARHVCLNQSIDTYTMVDKQTLE 427

  Fly   443 VCGKSFADRSNMTLHHRLHSGIKPFSCPLCPKAFTKKHHLKTH 485
            :|  :|.:.|.|  .:.|....||:.|.||.|.|:..:.:..|
Human   428 LC--TFEEGSQM--DNMLVQTNKPYKCNLCDKTFSTPNEVVKH 466

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15269NP_609739.2 C2H2 Zn finger 300..320 CDD:275368 4/19 (21%)
COG5048 <316..502 CDD:227381 54/234 (23%)
C2H2 Zn finger 327..347 CDD:275368 6/19 (32%)
zf-C2H2 356..377 CDD:278523 5/27 (19%)
C2H2 Zn finger 357..377 CDD:275368 4/26 (15%)
zf-H2C2_2 369..394 CDD:290200 6/45 (13%)
C2H2 Zn finger 385..405 CDD:275368 5/19 (26%)
zf-H2C2_2 397..422 CDD:290200 12/30 (40%)
C2H2 Zn finger 413..433 CDD:275368 7/25 (28%)
zf-H2C2_2 426..449 CDD:290200 4/22 (18%)
zf-C2H2 439..461 CDD:278523 4/21 (19%)
C2H2 Zn finger 441..461 CDD:275368 4/19 (21%)
zf-C2H2 467..489 CDD:278523 6/19 (32%)
C2H2 Zn finger 469..489 CDD:275368 6/17 (35%)
C2H2 Zn finger 497..515 CDD:275368
ZBTB2NP_065912.1 BTB 14..>84 CDD:306997
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 149..231 18/94 (19%)
C2H2 Zn finger 256..276 CDD:275368 6/19 (32%)
zf-C2H2 363..385 CDD:306579 7/21 (33%)
C2H2 Zn finger 365..385 CDD:275368 5/19 (26%)
zf-H2C2_2 377..399 CDD:316026 11/22 (50%)
C2H2 Zn finger 392..443 CDD:275368 13/54 (24%)
C2H2 Zn finger 450..466 CDD:275368 5/15 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.