DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15269 and ZNF286A

DIOPT Version :9

Sequence 1:NP_609739.2 Gene:CG15269 / 34887 FlyBaseID:FBgn0028878 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_001275571.1 Gene:ZNF286A / 57335 HGNCID:13501 Length:564 Species:Homo sapiens


Alignment Length:276 Identity:104/276 - (37%)
Similarity:141/276 - (51%) Gaps:16/276 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   291 TSAEEISYKCRICEKVFGCSETLQAHEKTHKSPR-YECADCGKGFSQLRNYKYHLSVHRGTKEFA 354
            |..|:..:||..|.::|.....|..|::.|...: |.|.:|||.||...|...|...|   ....
Human   279 TYKEKKPHKCNDCGELFTYHSVLIRHQRVHTGEKPYTCNECGKSFSHRANLTKHQRTH---TRIL 340

  Fly   355 AECPECGKTFNDKGYLSSHLKIHRNRKEYECPYCPKSFNQRVAFNMHVRIHTGVKPHKCNECGKR 419
            .||.||.|||.:...|::|.:||...:.|||..|.|.||:......|..|||||||::||||.|.
Human   341 FECSECKKTFTESSSLATHQRIHVGERPYECNECGKGFNRSTHLVQHQLIHTGVKPYECNECDKA 405

  Fly   420 FSRKMLLKQHMRTHSGEKPYQCSVCGKSFADRSNMTLHHRLHSGIKPFSCPLCPKAFTKKHHLKT 484
            |.....|.:|.|||:|||||:|..|||:|:..|::|.|.|:|:|.||:.|..|.|.|::..||..
Human   406 FIHSSALIKHQRTHTGEKPYKCQECGKAFSHCSSLTKHQRVHTGEKPYECSECGKTFSQSTHLVQ 470

  Fly   485 HLNYHTGCKPYVCPHPNCNQAFTQSSNMRTHAK--------KCQYRPLDGLTVTSSALPVPGKQQ 541
            |...|||.|||.|  ..|.:.|::|||...|.:        ||.  ......:.||||....:..
Human   471 HQRIHTGEKPYEC--NECGKTFSRSSNFAKHQRIHIGKKPYKCS--ECGKAFIHSSALIQHQRTH 531

  Fly   542 TGPPPTLAMAMAQTFQ 557
            ||..|.......::|:
Human   532 TGEKPFRCNECGKSFK 547

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15269NP_609739.2 C2H2 Zn finger 300..320 CDD:275368 5/19 (26%)
COG5048 <316..502 CDD:227381 81/186 (44%)
C2H2 Zn finger 327..347 CDD:275368 8/19 (42%)
zf-C2H2 356..377 CDD:278523 9/20 (45%)
C2H2 Zn finger 357..377 CDD:275368 8/19 (42%)
zf-H2C2_2 369..394 CDD:290200 10/24 (42%)
C2H2 Zn finger 385..405 CDD:275368 6/19 (32%)
zf-H2C2_2 397..422 CDD:290200 14/24 (58%)
C2H2 Zn finger 413..433 CDD:275368 9/19 (47%)
zf-H2C2_2 426..449 CDD:290200 14/22 (64%)
zf-C2H2 439..461 CDD:278523 10/21 (48%)
C2H2 Zn finger 441..461 CDD:275368 9/19 (47%)
zf-C2H2 467..489 CDD:278523 7/21 (33%)
C2H2 Zn finger 469..489 CDD:275368 7/19 (37%)
C2H2 Zn finger 497..515 CDD:275368 6/17 (35%)
ZNF286ANP_001275571.1 KRAB 88..141 CDD:214630
KRAB 88..123 CDD:279668
COG5048 <265..400 CDD:227381 45/123 (37%)
C2H2 Zn finger 288..308 CDD:275368 5/19 (26%)
zf-H2C2_2 301..325 CDD:290200 9/23 (39%)
C2H2 Zn finger 316..336 CDD:275368 8/19 (42%)
C2H2 Zn finger 343..363 CDD:275368 8/19 (42%)
zf-H2C2_2 355..380 CDD:290200 10/24 (42%)
C2H2 Zn finger 371..391 CDD:275368 6/19 (32%)
zf-H2C2_2 383..406 CDD:290200 13/22 (59%)
COG5048 <395..550 CDD:227381 61/157 (39%)
zf-C2H2 397..419 CDD:278523 9/21 (43%)
C2H2 Zn finger 399..419 CDD:275368 9/19 (47%)
zf-H2C2_2 411..436 CDD:290200 15/24 (63%)
C2H2 Zn finger 427..447 CDD:275368 9/19 (47%)
zf-H2C2_2 439..464 CDD:290200 11/24 (46%)
C2H2 Zn finger 455..475 CDD:275368 7/19 (37%)
zf-H2C2_2 467..492 CDD:290200 12/26 (46%)
C2H2 Zn finger 483..503 CDD:275368 7/21 (33%)
zf-H2C2_2 495..518 CDD:290200 4/24 (17%)
C2H2 Zn finger 511..531 CDD:275368 5/21 (24%)
zf-H2C2_2 523..548 CDD:290200 6/25 (24%)
C2H2 Zn finger 539..559 CDD:275368 1/9 (11%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.