| Sequence 1: | NP_609739.2 | Gene: | CG15269 / 34887 | FlyBaseID: | FBgn0028878 | Length: | 587 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_683959.6 | Gene: | zbtb47a / 556134 | ZFINID: | ZDB-GENE-081104-121 | Length: | 671 | Species: | Danio rerio |
| Alignment Length: | 248 | Identity: | 83/248 - (33%) |
|---|---|---|---|
| Similarity: | 120/248 - (48%) | Gaps: | 7/248 - (2%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 300 CRICEKVFGCSETLQAHEKTHKSPRYECADCGKGFSQLRNYKYHLSVHRGTKEFAAECPECGKTF 364
Fly 365 NDKGYLSSHLKIHRNRKEYECPYCPKSFNQRVAFNMHVRIHTGVKPHKCNECGKRFSRKMLLKQH 429
Fly 430 MRTHSGEKPYQCSVCGKSFADRSNMTLHHRLHSGIKPFSCPLCPKAFTKKHHLKTHLNYHTGCKP 494
Fly 495 YVCPHPNCNQAFTQSSNMRTHAKKC-QYRP---LDGLTVTS-SALPVPGKQQT 542 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG15269 | NP_609739.2 | C2H2 Zn finger | 300..320 | CDD:275368 | 6/19 (32%) |
| COG5048 | <316..502 | CDD:227381 | 62/185 (34%) | ||
| C2H2 Zn finger | 327..347 | CDD:275368 | 7/19 (37%) | ||
| zf-C2H2 | 356..377 | CDD:278523 | 5/20 (25%) | ||
| C2H2 Zn finger | 357..377 | CDD:275368 | 5/19 (26%) | ||
| zf-H2C2_2 | 369..394 | CDD:290200 | 7/24 (29%) | ||
| C2H2 Zn finger | 385..405 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 397..422 | CDD:290200 | 9/24 (38%) | ||
| C2H2 Zn finger | 413..433 | CDD:275368 | 8/19 (42%) | ||
| zf-H2C2_2 | 426..449 | CDD:290200 | 10/22 (45%) | ||
| zf-C2H2 | 439..461 | CDD:278523 | 6/21 (29%) | ||
| C2H2 Zn finger | 441..461 | CDD:275368 | 6/19 (32%) | ||
| zf-C2H2 | 467..489 | CDD:278523 | 7/21 (33%) | ||
| C2H2 Zn finger | 469..489 | CDD:275368 | 7/19 (37%) | ||
| C2H2 Zn finger | 497..515 | CDD:275368 | 5/17 (29%) | ||
| zbtb47a | XP_683959.6 | BTB | 32..137 | CDD:279045 | |
| BTB | 46..141 | CDD:197585 | |||
| C2H2 Zn finger | 351..370 | CDD:275368 | |||
| C2H2 Zn finger | 378..397 | CDD:275368 | 6/18 (33%) | ||
| C2H2 Zn finger | 405..425 | CDD:275368 | 7/19 (37%) | ||
| C2H2 Zn finger | 435..455 | CDD:275368 | 5/19 (26%) | ||
| zf-H2C2_2 | 447..472 | CDD:290200 | 7/24 (29%) | ||
| C2H2 Zn finger | 463..483 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 475..498 | CDD:290200 | 7/22 (32%) | ||
| C2H2 Zn finger | 491..511 | CDD:275368 | 8/19 (42%) | ||
| C2H2 Zn finger | 519..539 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 531..556 | CDD:290200 | 9/24 (38%) | ||
| C2H2 Zn finger | 547..567 | CDD:275368 | 7/19 (37%) | ||
| zf-H2C2_2 | 559..582 | CDD:290200 | 11/24 (46%) | ||
| C2H2 Zn finger | 575..592 | CDD:275368 | 6/18 (33%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | O | PTHR24384 |
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.100 | |||||