DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15269 and si:dkey-262g12.9

DIOPT Version :9

Sequence 1:NP_609739.2 Gene:CG15269 / 34887 FlyBaseID:FBgn0028878 Length:587 Species:Drosophila melanogaster
Sequence 2:XP_021331485.1 Gene:si:dkey-262g12.9 / 555910 ZFINID:ZDB-GENE-161017-28 Length:380 Species:Danio rerio


Alignment Length:224 Identity:84/224 - (37%)
Similarity:131/224 - (58%) Gaps:5/224 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   295 EISYKCRICEKVFGCSETLQAHEKTHKSPR-YECADCGKGFSQLRNYKYHLSVHRGTKEFAAECP 358
            |..:.|.:|.|.|...:.::.|.:.|...| |.|..|||.|.|::..|.|:.:|.|.:.:|  |.
Zfish   134 EKPFSCDLCGKSFNLQKNMKIHRRIHTGERPYACQQCGKRFRQIQILKNHIKLHTGERPYA--CA 196

  Fly   359 ECGKTFNDKGYLSSHLKIHRNRKEYECPYCPKSFNQRVAFNMHVRIHTGVKPHKCNECGKRFSRK 423
            :||.:|..|..|.:|:.:|...:.:.|..|..:|..:....:|::||:|.||..|.:|||.|:|:
Zfish   197 QCGMSFIQKQKLEAHMAVHNTERPFACHQCGGNFAHKDYLTIHMKIHSGEKPFACQQCGKSFNRR 261

  Fly   424 MLLKQHMRTHSGEKPYQCSVCGKSFADRSNMTLHHRLHSGIKPFSCPLCPKAFTKKHHLKTHLNY 488
            ..||.|||.|:|||||.|:.|||||..::|:..|.|.|:|.||::|.:|.|.||..::|..|:..
Zfish   262 QCLKVHMRVHTGEKPYICAQCGKSFTQKNNLNYHMRTHTGEKPYTCSICGKHFTCNNYLTAHMRT 326

  Fly   489 HTGCKPYVCPHPNCNQAFTQSSNMRTHAK 517
            |||.:|::|  ..|.:::.|..|:..|.|
Zfish   327 HTGERPFIC--GQCGKSYCQRRNLSQHMK 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15269NP_609739.2 C2H2 Zn finger 300..320 CDD:275368 5/19 (26%)
COG5048 <316..502 CDD:227381 74/186 (40%)
C2H2 Zn finger 327..347 CDD:275368 8/19 (42%)
zf-C2H2 356..377 CDD:278523 7/20 (35%)
C2H2 Zn finger 357..377 CDD:275368 7/19 (37%)
zf-H2C2_2 369..394 CDD:290200 6/24 (25%)
C2H2 Zn finger 385..405 CDD:275368 4/19 (21%)
zf-H2C2_2 397..422 CDD:290200 11/24 (46%)
C2H2 Zn finger 413..433 CDD:275368 11/19 (58%)
zf-H2C2_2 426..449 CDD:290200 16/22 (73%)
zf-C2H2 439..461 CDD:278523 10/21 (48%)
C2H2 Zn finger 441..461 CDD:275368 9/19 (47%)
zf-C2H2 467..489 CDD:278523 7/21 (33%)
C2H2 Zn finger 469..489 CDD:275368 7/19 (37%)
C2H2 Zn finger 497..515 CDD:275368 4/17 (24%)
si:dkey-262g12.9XP_021331485.1 COG5048 <75..263 CDD:227381 43/130 (33%)
C2H2 Zn finger 83..103 CDD:275368
C2H2 Zn finger 111..131 CDD:275368
C2H2 Zn finger 139..159 CDD:275368 5/19 (26%)
C2H2 Zn finger 167..187 CDD:275368 8/19 (42%)
C2H2 Zn finger 195..215 CDD:275368 7/19 (37%)
COG5048 216..>328 CDD:227381 46/111 (41%)
C2H2 Zn finger 223..243 CDD:275368 4/19 (21%)
C2H2 Zn finger 251..271 CDD:275368 11/19 (58%)
C2H2 Zn finger 279..299 CDD:275368 9/19 (47%)
C2H2 Zn finger 307..327 CDD:275368 7/19 (37%)
C2H2 Zn finger 335..355 CDD:275368 6/21 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.