DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15269 and PLAGL1

DIOPT Version :9

Sequence 1:NP_609739.2 Gene:CG15269 / 34887 FlyBaseID:FBgn0028878 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_001074420.1 Gene:PLAGL1 / 5325 HGNCID:9046 Length:463 Species:Homo sapiens


Alignment Length:310 Identity:89/310 - (28%)
Similarity:129/310 - (41%) Gaps:48/310 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   297 SYKCRICEKVFGCSETLQAHEKTHKSPR-YECA--DCGKGFSQLRNYKYHLSVHRGTKEFAAECP 358
            ::.|::|.|.|...|....|..:|...| |:|.  ||||.|........|::.|...|  :.:|.
Human     3 TFPCQLCGKTFLTLEKFTIHNYSHSRERPYKCVQPDCGKAFVSRYKLMRHMATHSPQK--SHQCA 65

  Fly   359 ECGKTFNDKGYLSSHLKIH-RNRKEYECPYCPKSFNQRVAFNMHVRIHTGVKPH-KCNECGKRFS 421
            .|.||||.|.:|.:||:.| .|:..:.|..|.|.:|..:.:..|:.:|...... .|..|.....
Human    66 HCEKTFNRKDHLKNHLQTHDPNKMAFGCEECGKKYNTMLGYKRHLALHAASSGDLTCGVCALELG 130

  Fly   422 RKMLLKQHMRTHSGEKP--------YQCSVCGKSFADRSNMTLHHRLHSGIKPFSCPLCPKAFTK 478
            ...:|..|::.|:.|||        :||..|.:.|..|.::..|..:|:|.|.|.|..|.:.|.:
Human   131 STEVLLDHLKAHAEEKPPSGTKEKKHQCDHCERCFYTRKDVRRHLVVHTGCKDFLCQFCAQRFGR 195

  Fly   479 KHHL-----KTHL------NYHTGCKPYVCPHPNCNQAF-TQSSNMRTHAKKCQYRPL-----DG 526
            |.||     |||.      :..||         :....| |.|.:.:..|......||     :|
Human   196 KDHLTRHTKKTHSQELMKESLQTG---------DLLSTFHTISPSFQLKAAALPPFPLGASAQNG 251

  Fly   527 LTVTSSALPVPGKQQTGPPPTLAMAMAQTFQ-MPPPPGVLTPGSGPSQPP 575
            |   :|:||......|..||..|   ||..| :|.....|.|...|..||
Human   252 L---ASSLPAEVHSLTLSPPEQA---AQPMQPLPESLASLHPSVSPGSPP 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15269NP_609739.2 C2H2 Zn finger 300..320 CDD:275368 6/19 (32%)
COG5048 <316..502 CDD:227381 60/209 (29%)
C2H2 Zn finger 327..347 CDD:275368 7/21 (33%)
zf-C2H2 356..377 CDD:278523 10/20 (50%)
C2H2 Zn finger 357..377 CDD:275368 10/19 (53%)
zf-H2C2_2 369..394 CDD:290200 8/25 (32%)
C2H2 Zn finger 385..405 CDD:275368 5/19 (26%)
zf-H2C2_2 397..422 CDD:290200 4/25 (16%)
C2H2 Zn finger 413..433 CDD:275368 4/19 (21%)
zf-H2C2_2 426..449 CDD:290200 9/30 (30%)
zf-C2H2 439..461 CDD:278523 6/21 (29%)
C2H2 Zn finger 441..461 CDD:275368 5/19 (26%)
zf-C2H2 467..489 CDD:278523 10/32 (31%)
C2H2 Zn finger 469..489 CDD:275368 9/30 (30%)
C2H2 Zn finger 497..515 CDD:275368 3/18 (17%)
PLAGL1NP_001074420.1 C2H2 Zn finger 6..26 CDD:275368 6/19 (32%)
SFP1 <29..109 CDD:227516 27/81 (33%)
C2H2 Zn finger 34..56 CDD:275368 7/21 (33%)
C2H2 Zn finger 64..84 CDD:275368 10/19 (53%)
COG5236 <80..>207 CDD:227561 35/126 (28%)
C2H2 Zn finger 93..113 CDD:275368 5/19 (26%)
C2H2 Zn finger 122..142 CDD:275368 4/19 (21%)
C2H2 Zn finger 158..178 CDD:275368 5/19 (26%)
C2H2 Zn finger 186..207 CDD:275368 7/20 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 268..306 11/31 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.