| Sequence 1: | NP_609739.2 | Gene: | CG15269 / 34887 | FlyBaseID: | FBgn0028878 | Length: | 587 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001013324.1 | Gene: | zgc:113135 / 503712 | ZFINID: | ZDB-GENE-050306-7 | Length: | 323 | Species: | Danio rerio |
| Alignment Length: | 226 | Identity: | 86/226 - (38%) |
|---|---|---|---|
| Similarity: | 117/226 - (51%) | Gaps: | 7/226 - (3%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 292 SAEEISYKCRICEKVFGCSETLQAHEKTHKSPRYECADCGKGFSQLRNYKYHLSVHRGTKEFAAE 356
Fly 357 CPECGKTFNDKGYLSSHLKIHRNRKEYECPYCPKSFNQRVAFNMHVRIHTGVKPHKCNECGKRFS 421
Fly 422 RKMLLKQHMRTHSGEKPYQCSVCGKSFADRSNMTLHHRLHSGIKPFSCPLCPKAFTKKHHLKTHL 486
Fly 487 NYHTGCKPYVCPHPNCNQAFTQSSNMRTHAK 517 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG15269 | NP_609739.2 | C2H2 Zn finger | 300..320 | CDD:275368 | 5/19 (26%) |
| COG5048 | <316..502 | CDD:227381 | 77/185 (42%) | ||
| C2H2 Zn finger | 327..347 | CDD:275368 | 7/19 (37%) | ||
| zf-C2H2 | 356..377 | CDD:278523 | 8/20 (40%) | ||
| C2H2 Zn finger | 357..377 | CDD:275368 | 8/19 (42%) | ||
| zf-H2C2_2 | 369..394 | CDD:290200 | 10/24 (42%) | ||
| C2H2 Zn finger | 385..405 | CDD:275368 | 8/19 (42%) | ||
| zf-H2C2_2 | 397..422 | CDD:290200 | 10/24 (42%) | ||
| C2H2 Zn finger | 413..433 | CDD:275368 | 11/19 (58%) | ||
| zf-H2C2_2 | 426..449 | CDD:290200 | 15/22 (68%) | ||
| zf-C2H2 | 439..461 | CDD:278523 | 8/21 (38%) | ||
| C2H2 Zn finger | 441..461 | CDD:275368 | 7/19 (37%) | ||
| zf-C2H2 | 467..489 | CDD:278523 | 10/21 (48%) | ||
| C2H2 Zn finger | 469..489 | CDD:275368 | 9/19 (47%) | ||
| C2H2 Zn finger | 497..515 | CDD:275368 | 3/17 (18%) | ||
| zgc:113135 | NP_001013324.1 | C2H2 Zn finger | 79..95 | CDD:275368 | 4/15 (27%) |
| C2H2 Zn finger | 103..123 | CDD:275368 | 7/19 (37%) | ||
| zf-H2C2_2 | 115..138 | CDD:290200 | 9/24 (38%) | ||
| C2H2 Zn finger | 131..151 | CDD:275368 | 8/19 (42%) | ||
| COG5048 | <159..316 | CDD:227381 | 57/133 (43%) | ||
| C2H2 Zn finger | 159..179 | CDD:275368 | 8/19 (42%) | ||
| zf-H2C2_2 | 171..196 | CDD:290200 | 10/24 (42%) | ||
| C2H2 Zn finger | 187..207 | CDD:275368 | 11/19 (58%) | ||
| zf-H2C2_2 | 199..222 | CDD:290200 | 14/22 (64%) | ||
| C2H2 Zn finger | 215..235 | CDD:275368 | 7/19 (37%) | ||
| zf-H2C2_2 | 227..252 | CDD:290200 | 10/24 (42%) | ||
| C2H2 Zn finger | 243..263 | CDD:275368 | 9/19 (47%) | ||
| C2H2 Zn finger | 271..291 | CDD:275368 | 5/21 (24%) | ||
| C2H2 Zn finger | 298..318 | CDD:275368 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||