DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15269 and Zfp773-ps1

DIOPT Version :9

Sequence 1:NP_609739.2 Gene:CG15269 / 34887 FlyBaseID:FBgn0028878 Length:587 Species:Drosophila melanogaster
Sequence 2:XP_017445439.1 Gene:Zfp773-ps1 / 502292 RGDID:1563793 Length:424 Species:Rattus norvegicus


Alignment Length:418 Identity:121/418 - (28%)
Similarity:191/418 - (45%) Gaps:45/418 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 AAAAAGLSTPPTSPYQTHQHQQHLPNQQKRFFAPYVI--------NGSVPPPPPLQQQQQ----- 172
            |.|..|::....:.|...:..:.|.:.|:|.:...::        :|.||....:.|.:.     
  Rat    17 AQAQGGVAFHDVAIYFLREEWRLLDDSQRRLYHHVMMEVFVLMSSSGLVPSGTDITQLESSGDRF 81

  Fly   173 -PLIR--TKSTACTRPDCPECLDYYQRLQTGGYKQTAPLISPAASSVSSSTGSIRPVRDLIMSAT 234
             |.:|  |......:..|.:.|...:|    |...|   :.| ...:||:...::          
  Rat    82 IPALRFLTPRVEPAKIPCEQTLSTTER----GLNVT---MLP-QQELSSAENHLQ---------- 128

  Fly   235 GGAASTNISLT--TVTNLSLNSVQATAVGMMPKMTGGLI-TTAVGSNSGAIGGIGGYNATSAEEI 296
              .|...:|:|  ..:::|..::|:|...|..:...||: ..|..|:.|.........||.:|:.
  Rat   129 --RAEHRLSVTKRNRSDISEKTLQSTDNTMDSRTLSGLLGHHATHSDGGQPRSTKKGKATHSEKR 191

  Fly   297 SYK-CRICEKVFGCSETLQAHEKTHKSPR-YECADCGKGFSQLRNYKYHLSVHRGTKEFAAECPE 359
            :|| |..|.|.|.|...|..|.:.|...: ::|::|.|.|.|..:...||.||.|.|.|  .|.:
  Rat   192 NYKCCSYCGKSFNCRSLLIRHRRIHTGEKPFKCSECEKSFIQKADLNQHLKVHTGEKPF--RCSK 254

  Fly   360 CGKTFNDKGYLSSHLKIHRNRKEYECPYCPKSFNQRVAFNMHVRIHTGVKPHKCNECGKRFSRKM 424
            |||.|.....|..|.::|...|.|:|..|.:|:..|.:...|..:|||.||:||:||||.|..|.
  Rat   255 CGKKFKHSRSLVGHQRLHTGEKPYKCNQCGESYVNRSSLIRHNLVHTGEKPYKCSECGKLFKEKS 319

  Fly   425 LLKQHMRTHSGEKPYQCSVCGKSFADRSNMTLHHRLHSGIKPFSCPLCPKAFTKKHHLKTHLNYH 489
            .|..|.|.|:||:|::||.|.|||...|::..|.::||..|||.|.:|.:.||.::.|..|..:|
  Rat   320 SLVYHARVHTGERPFECSQCKKSFKKNSHLVKHRKVHSRGKPFKCNVCGRFFTMRYILVKHQRFH 384

  Fly   490 TGCKPYVCPHPNCNQAFTQSSNMRTHAK 517
            |..|.:.|  ..|.:.|...:.:..|.|
  Rat   385 TAEKHHEC--KECGKVFCYRTGLSRHRK 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15269NP_609739.2 C2H2 Zn finger 300..320 CDD:275368 7/19 (37%)
COG5048 <316..502 CDD:227381 72/186 (39%)
C2H2 Zn finger 327..347 CDD:275368 7/19 (37%)
zf-C2H2 356..377 CDD:278523 7/20 (35%)
C2H2 Zn finger 357..377 CDD:275368 7/19 (37%)
zf-H2C2_2 369..394 CDD:290200 8/24 (33%)
C2H2 Zn finger 385..405 CDD:275368 5/19 (26%)
zf-H2C2_2 397..422 CDD:290200 13/24 (54%)
C2H2 Zn finger 413..433 CDD:275368 10/19 (53%)
zf-H2C2_2 426..449 CDD:290200 12/22 (55%)
zf-C2H2 439..461 CDD:278523 8/21 (38%)
C2H2 Zn finger 441..461 CDD:275368 8/19 (42%)
zf-C2H2 467..489 CDD:278523 7/21 (33%)
C2H2 Zn finger 469..489 CDD:275368 6/19 (32%)
C2H2 Zn finger 497..515 CDD:275368 3/17 (18%)
Zfp773-ps1XP_017445439.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24384
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.