DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15269 and Fezf1

DIOPT Version :9

Sequence 1:NP_609739.2 Gene:CG15269 / 34887 FlyBaseID:FBgn0028878 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_001102694.1 Gene:Fezf1 / 500048 RGDID:1560480 Length:475 Species:Rattus norvegicus


Alignment Length:511 Identity:137/511 - (26%)
Similarity:197/511 - (38%) Gaps:114/511 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 AAAAAAG--LSTPPTSPYQTHQHQQHLPNQQKRFFAPYVINGSVPPPPPLQQQQQPLIRTKSTAC 182
            |.|.|.|  :||.....:...:.....| :.|....|:.:.|:||...|    :..|....|..|
  Rat    14 ATAPARGNVMSTSKPLAFSIERIMARTP-EPKALPVPHFLQGAVPKGDP----KHSLHLNSSIPC 73

  Fly   183 TRPDCPECLDYYQRLQTGGYK--------QTAPLISPAASSVSSSTGSIRPVRDLIMSATGGAAS 239
            ..|..|...|...:....|.:        ...|.::|:|.:.|.|        ||:         
  Rat    74 MIPFVPVAYDTNSKAGVNGSEPRKASLEVPAPPAVAPSAPAFSCS--------DLL--------- 121

  Fly   240 TNISLTTVTNLSLNSVQATAVGMMPKMTGGLITTAVGSNSG--AIGGIGGYNATSAEEISYKCRI 302
             |.:|:...:|:.::        :|.....|:...|.::|.  |:|.:...|.....        
  Rat   122 -NCALSLKGDLARDA--------LPLQQYKLVRPRVVNHSSFHAMGALCYLNRGDGP-------- 169

  Fly   303 CEKVFG----------CSETLQAHEKTHKS-------PRYECADCGKGF-----SQLRNYKYHLS 345
            |....|          .|..|....||:.:       |..|....|..|     :||.||....:
  Rat   170 CHPAAGVNIHPVASYFLSSPLHPQPKTYLAERNKLVVPAVEKLPSGVAFKDLSQAQLHNYMKESA 234

  Fly   346 -------------VHRGT---KEFAAECPECGKTFNDKGYLSSHLKIHRNRKEYECPYCPKSFNQ 394
                         ..||:   |.....|..|||.||....|:.|:.:|...:.:.|..|.|.|.|
  Rat   235 QLLSEKIAFKTSDFSRGSPNAKPKVFTCEVCGKVFNAHYNLTRHMPVHTGARPFVCKVCGKGFRQ 299

  Fly   395 RVAFNMHVRIHTGVKPHKCNECGKRFSRKMLLKQHMRTHSGEKPYQCSVCGKSFADRSNMTLHHR 459
            ......|..|||..||||||:|||.|:|...|..|.|.|:|.||:.|..|||.|..:.|...|..
  Rat   300 ASTLCRHKIIHTQEKPHKCNQCGKAFNRSSTLNTHTRIHAGYKPFVCEFCGKGFHQKGNYKNHKL 364

  Fly   460 LHSGIKPFSCPLCPKAFTKKHHLKTHLNYHTGCKPYVCPHPNCNQAFTQSSNMRTHAKKCQYRPL 524
            .|||.|.|.|.:|.|||.:.::|..|::.|...||:.|  |.|.:.|.::.:::.|.:|.....|
  Rat   365 THSGEKQFKCNICNKAFHQVYNLTFHMHTHNDKKPFTC--PTCGKGFCRNFDLKKHVRKLHDSSL 427

  Fly   525 DGLTVTSSALPVPGKQQTGPPPTLAMAMAQTFQMPPPPGVLTPGSGPSQPPSQQTL 580
             |||.|.:     |:..:.|||.|        |.|||..:         ||.|.||
  Rat   428 -GLTRTPT-----GEPGSDPPPQL--------QQPPPAPL---------PPLQPTL 460

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15269NP_609739.2 C2H2 Zn finger 300..320 CDD:275368 5/29 (17%)
COG5048 <316..502 CDD:227381 73/213 (34%)
C2H2 Zn finger 327..347 CDD:275368 6/37 (16%)
zf-C2H2 356..377 CDD:278523 8/20 (40%)
C2H2 Zn finger 357..377 CDD:275368 8/19 (42%)
zf-H2C2_2 369..394 CDD:290200 7/24 (29%)
C2H2 Zn finger 385..405 CDD:275368 6/19 (32%)
zf-H2C2_2 397..422 CDD:290200 14/24 (58%)
C2H2 Zn finger 413..433 CDD:275368 10/19 (53%)
zf-H2C2_2 426..449 CDD:290200 11/22 (50%)
zf-C2H2 439..461 CDD:278523 7/21 (33%)
C2H2 Zn finger 441..461 CDD:275368 7/19 (37%)
zf-C2H2 467..489 CDD:278523 8/21 (38%)
C2H2 Zn finger 469..489 CDD:275368 7/19 (37%)
C2H2 Zn finger 497..515 CDD:275368 4/17 (24%)
Fezf1NP_001102694.1 C2H2 Zn finger 262..282 CDD:275368 8/19 (42%)
COG5048 <287..421 CDD:227381 54/135 (40%)
C2H2 Zn finger 290..310 CDD:275368 6/19 (32%)
zf-H2C2_2 305..327 CDD:290200 14/21 (67%)
C2H2 Zn finger 318..338 CDD:275368 10/19 (53%)
C2H2 Zn finger 346..366 CDD:275368 7/19 (37%)
zf-H2C2_2 358..383 CDD:290200 12/24 (50%)
C2H2 Zn finger 374..394 CDD:275368 7/19 (37%)
C2H2 Zn finger 402..420 CDD:275370 5/19 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.