DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15269 and osr1

DIOPT Version :9

Sequence 1:NP_609739.2 Gene:CG15269 / 34887 FlyBaseID:FBgn0028878 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_001008046.1 Gene:osr1 / 493408 XenbaseID:XB-GENE-481410 Length:259 Species:Xenopus tropicalis


Alignment Length:162 Identity:46/162 - (28%)
Similarity:74/162 - (45%) Gaps:17/162 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   311 ETLQAHEKTHKSPRYECADCGKGFSQLRNYKYHLSVHRGTK-------EFAAECPECGKTFNDKG 368
            |:.....||  .||::.|:.....:|..:.|......:|:.       :.....||...|   :|
 Frog    99 ESPNLSNKT--KPRFDFANLALAATQEDHCKLGQMDDQGSPPTIGGLLDVTKLTPEKKPT---RG 158

  Fly   369 YLSSHLKIHRNRKEYECPYCPKSFNQRVAFNMHVRIHTGVKPHKCNECGKRFSRKMLLKQHMRTH 433
            .|.|     :.:||:.|.:|.:.|.:.....:|.|.||..:|:.|:.|.|.|.|:..|:.|...|
 Frog   159 RLPS-----KTKKEFVCKFCGRHFTKSYNLLIHERTHTDERPYTCDICHKAFRRQDHLRDHRYIH 218

  Fly   434 SGEKPYQCSVCGKSFADRSNMTLHHRLHSGIK 465
            |.|||::|..|||.|.....:.:|..||:.:|
 Frog   219 SKEKPFKCQECGKGFCQSRTLAVHKTLHTQVK 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15269NP_609739.2 C2H2 Zn finger 300..320 CDD:275368 2/8 (25%)
COG5048 <316..502 CDD:227381 45/157 (29%)
C2H2 Zn finger 327..347 CDD:275368 3/19 (16%)
zf-C2H2 356..377 CDD:278523 6/20 (30%)
C2H2 Zn finger 357..377 CDD:275368 6/19 (32%)
zf-H2C2_2 369..394 CDD:290200 7/24 (29%)
C2H2 Zn finger 385..405 CDD:275368 5/19 (26%)
zf-H2C2_2 397..422 CDD:290200 9/24 (38%)
C2H2 Zn finger 413..433 CDD:275368 7/19 (37%)
zf-H2C2_2 426..449 CDD:290200 11/22 (50%)
zf-C2H2 439..461 CDD:278523 6/21 (29%)
C2H2 Zn finger 441..461 CDD:275368 6/19 (32%)
zf-C2H2 467..489 CDD:278523
C2H2 Zn finger 469..489 CDD:275368
C2H2 Zn finger 497..515 CDD:275368
osr1NP_001008046.1 zf-C2H2 168..190 CDD:333835 5/21 (24%)
C2H2 Zn finger 170..190 CDD:275368 5/19 (26%)
zf-H2C2_2 182..207 CDD:372612 9/24 (38%)
C2H2 Zn finger 198..218 CDD:275368 7/19 (37%)
zf-H2C2_2 210..233 CDD:372612 11/22 (50%)
C2H2 Zn finger 226..246 CDD:275368 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.