DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15269 and AgaP_AGAP008232

DIOPT Version :9

Sequence 1:NP_609739.2 Gene:CG15269 / 34887 FlyBaseID:FBgn0028878 Length:587 Species:Drosophila melanogaster
Sequence 2:XP_317239.4 Gene:AgaP_AGAP008232 / 4578130 VectorBaseID:AGAP008232 Length:966 Species:Anopheles gambiae


Alignment Length:372 Identity:99/372 - (26%)
Similarity:147/372 - (39%) Gaps:85/372 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   243 SLTTVTNL---SLNSVQATAVGMMPKMTGGLITTAVGSNSGAIG---------GIGGYNATSAEE 295
            |.|.|..|   |:.:||        .:||..:...|...||::|         .:.|  .:||.:
Mosquito   120 STTPVEGLNPDSMRNVQ--------HITGKPLLVRVFDFSGSMGSKKTTGKDHSVRG--RSSAPD 174

  Fly   296 ISYKCRICEKVFGCSETLQAHEKTHKSPRYECADCGKGFSQLRNYKYHLSVHRGTKEFAAECPEC 360
            ||..| ....|||||:                  ||...  ||..:..|..........|.|..|
Mosquito   175 ISIIC-FRGSVFGCSK------------------CGSAI--LRTERGDLLGLDDEHGIDARCVVC 218

  Fly   361 GKTFNDKGYLSSHLKI--HRNRKEYECPYCPKSFNQRVAFNMH-VRIHTGVKPHKCNECGKRFSR 422
            .:..:|...|..||.|  |..:..|.|..||::::.|.:...| ..:|..::...|..|.|.|:.
Mosquito   219 DRQCHDIDQLDDHLVISHHYPKDAYRCELCPRAYSYRPSLLRHRAIVHGELRRFPCENCPKVFTD 283

  Fly   423 KMLLKQHMRTHS-GEKPYQCSVCGKSFADRSNMTLHHRLHSGIKPFSCPLCPKAFTKKHHLKTHL 486
            ...|::|:|||. |.:.:.|..|||:||..|.:..|..:||.:|||.|.:|.|::|:..:|..|.
Mosquito   284 PSNLQRHIRTHHVGARSHACPECGKTFATSSGLKQHTHIHSSVKPFQCEVCFKSYTQFSNLCRHR 348

  Fly   487 NYHTGCKPYV-CPHPNCNQAFTQSSNMRTHAKKCQYRPLDGLTVTSSAL--------------PV 536
            ..|..|:..: |  ..|..:|:.::::..|.:.|     |...||..:|              |.
Mosquito   349 RMHADCQVQIKC--NKCGDSFSTTTSLSKHKRFC-----DSTAVTRGSLHPGAHPSQLRHPHDPY 406

  Fly   537 P-------GKQQTGPPPTLAMAMAQTFQMPP---------PPGVLTP 567
            |       |..|.|.|...|.|.|.......         |||:.||
Mosquito   407 PHGTRSHSGGSQPGTPGGSAGASAAAAAAASGGPGALHSLPPGMATP 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15269NP_609739.2 C2H2 Zn finger 300..320 CDD:275368 6/19 (32%)
COG5048 <316..502 CDD:227381 53/190 (28%)
C2H2 Zn finger 327..347 CDD:275368 5/19 (26%)
zf-C2H2 356..377 CDD:278523 7/22 (32%)
C2H2 Zn finger 357..377 CDD:275368 7/21 (33%)
zf-H2C2_2 369..394 CDD:290200 9/26 (35%)
C2H2 Zn finger 385..405 CDD:275368 5/20 (25%)
zf-H2C2_2 397..422 CDD:290200 6/25 (24%)
C2H2 Zn finger 413..433 CDD:275368 7/19 (37%)
zf-H2C2_2 426..449 CDD:290200 10/23 (43%)
zf-C2H2 439..461 CDD:278523 8/21 (38%)
C2H2 Zn finger 441..461 CDD:275368 8/19 (42%)
zf-C2H2 467..489 CDD:278523 7/21 (33%)
C2H2 Zn finger 469..489 CDD:275368 6/19 (32%)
C2H2 Zn finger 497..515 CDD:275368 3/17 (18%)
AgaP_AGAP008232XP_317239.4 C2H2 Zn finger 215..237 CDD:275368 7/21 (33%)
C2H2 Zn finger 245..266 CDD:275368 5/20 (25%)
zf-C2H2 272..294 CDD:278523 7/21 (33%)
C2H2 Zn finger 274..294 CDD:275368 7/19 (37%)
zf-H2C2_2 286..312 CDD:290200 11/25 (44%)
C2H2 Zn finger 303..323 CDD:275368 8/19 (42%)
zf-C2H2_8 304..384 CDD:292531 26/86 (30%)
zf-C2H2 329..351 CDD:278523 7/21 (33%)
C2H2 Zn finger 331..351 CDD:275368 6/19 (32%)
C2H2 Zn finger 360..378 CDD:275368 4/19 (21%)
COG5048 820..>872 CDD:227381
zf-C2H2 820..842 CDD:278523
C2H2 Zn finger 822..842 CDD:275368
zf-H2C2_2 834..858 CDD:290200
C2H2 Zn finger 850..871 CDD:275368
zf-C2H2 877..899 CDD:278523
C2H2 Zn finger 879..899 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.