DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15269 and ZNF716

DIOPT Version :9

Sequence 1:NP_609739.2 Gene:CG15269 / 34887 FlyBaseID:FBgn0028878 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_001152751.1 Gene:ZNF716 / 441234 HGNCID:32458 Length:495 Species:Homo sapiens


Alignment Length:276 Identity:106/276 - (38%)
Similarity:139/276 - (50%) Gaps:24/276 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   295 EISYKCRICEKVFGCSETLQAHEKTHKSPR-YECADCGKGFSQLRNYKYHLSVHRGTKEFAAECP 358
            |.||||..|.|.|.||.||..|::.|...: |.|.:|||.||...:...|..:|.|.|.:.  |.
Human   210 EKSYKCEECGKSFNCSSTLTRHKRIHTGEKPYRCEECGKAFSWSASLTKHKRIHTGEKPYT--CE 272

  Fly   359 ECGKTFNDKGYLSSHLKIHRNRKEYECPYCPKSFNQRVAFNMHVRIHTGVKPHKCNECGKRFSRK 423
            |.||.|: :..|:::.:||...|.|.|..|.|:|::......|.|||||.:|:||.||||.||..
Human   273 ERGKVFS-RSTLTNYKRIHTGEKPYTCEECGKAFSRSSTLTNHKRIHTGERPYKCEECGKAFSLS 336

  Fly   424 MLLKQHMRTHSGEKPYQCSVCGKSFADRSNMTLHHRLHSGIKPFSCPLCPKAFTKKHHLKTHLNY 488
            ..||:|...|:|||.|.|..|||:|...|.:..|.|:|:|.||::|..|.|||:.......|...
Human   337 STLKKHKIVHTGEKLYTCEECGKAFTFSSTLNTHKRIHTGEKPYTCEECGKAFSLPSTFTYHKRT 401

  Fly   489 HTGCKPYVCPHPNCNQAFTQSSNMRTH-----------AKKCQYRPLDGLTVT-SSALPVPGKQQ 541
            |||.|||.|  ..|.:||..||.::.|           .|:|      |...| ||.|....:..
Human   402 HTGEKPYKC--EECGKAFNCSSTLKKHKIIHTGEKLYKCKEC------GKAFTFSSTLNTHKRIH 458

  Fly   542 TGPPPTLAMAMAQTFQ 557
            ||..|.......|||:
Human   459 TGEKPYKCEECDQTFK 474

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15269NP_609739.2 C2H2 Zn finger 300..320 CDD:275368 9/19 (47%)
COG5048 <316..502 CDD:227381 75/186 (40%)
C2H2 Zn finger 327..347 CDD:275368 7/19 (37%)
zf-C2H2 356..377 CDD:278523 6/20 (30%)
C2H2 Zn finger 357..377 CDD:275368 6/19 (32%)
zf-H2C2_2 369..394 CDD:290200 9/24 (38%)
C2H2 Zn finger 385..405 CDD:275368 6/19 (32%)
zf-H2C2_2 397..422 CDD:290200 14/24 (58%)
C2H2 Zn finger 413..433 CDD:275368 10/19 (53%)
zf-H2C2_2 426..449 CDD:290200 12/22 (55%)
zf-C2H2 439..461 CDD:278523 9/21 (43%)
C2H2 Zn finger 441..461 CDD:275368 8/19 (42%)
zf-C2H2 467..489 CDD:278523 6/21 (29%)
C2H2 Zn finger 469..489 CDD:275368 6/19 (32%)
C2H2 Zn finger 497..515 CDD:275368 6/17 (35%)
ZNF716NP_001152751.1 KRAB 16..76 CDD:214630
KRAB 16..55 CDD:279668
C2H2 Zn finger 160..179 CDD:275368
C2H2 Zn finger 187..207 CDD:275368
COG5048 211..>494 CDD:227381 105/275 (38%)
C2H2 Zn finger 215..235 CDD:275368 9/19 (47%)
zf-H2C2_2 228..251 CDD:290200 8/22 (36%)
C2H2 Zn finger 243..263 CDD:275368 7/19 (37%)
zf-H2C2_2 283..307 CDD:290200 9/23 (39%)
C2H2 Zn finger 298..318 CDD:275368 6/19 (32%)
zf-H2C2_2 311..334 CDD:290200 13/22 (59%)
C2H2 Zn finger 326..346 CDD:275368 10/19 (53%)
CpXC 353..>398 CDD:291051 17/44 (39%)
C2H2 Zn finger 354..374 CDD:275368 8/19 (42%)
C2H2 Zn finger 382..402 CDD:275368 6/19 (32%)
zf-H2C2_2 398..419 CDD:290200 11/22 (50%)
C2H2 Zn finger 410..430 CDD:275368 7/21 (33%)
zf-H2C2_2 423..446 CDD:290200 4/28 (14%)
C2H2 Zn finger 438..458 CDD:275368 7/25 (28%)
zf-H2C2_2 451..474 CDD:290200 6/22 (27%)
C2H2 Zn finger 466..486 CDD:275368 3/9 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24384
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.