DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15269 and Zfp560

DIOPT Version :9

Sequence 1:NP_609739.2 Gene:CG15269 / 34887 FlyBaseID:FBgn0028878 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_001004190.2 Gene:Zfp560 / 434377 MGIID:1915280 Length:754 Species:Mus musculus


Alignment Length:566 Identity:167/566 - (29%)
Similarity:226/566 - (39%) Gaps:131/566 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 SNSIRSPQALGG--LAIPSTPYASGAYSMLPP---DLVAMANATKF-----YAQFFPHLLPAYAA 120
            ||.|:.|.:..|  |.....|   |.....||   ..:.:.|....     |.|.||......::
Mouse   130 SNEIQLPNSHNGKELCDIKPP---GEIIKEPPCSLTYIGIENTGNIYDCVQYGQLFPVCPKETSS 191

  Fly   121 AAAAAGL-------STPPTSPYQTHQHQ---------QHLPNQQKRFFAPYVINGSVPPPPPLQQ 169
            |....||       |...::.|||...|         |.:.:.|.....|    |.......|.:
Mouse   192 ADTGPGLRQYGKDFSMIASTAYQTTCVQSKFIESSEFQQVFDSQSSLQRP----GGSHSEDKLSE 252

  Fly   170 QQQ------PLIRTKSTA--CTRP---DCPEC---------LDYYQRLQTG-----------GYK 203
            ..|      |.:....:|  ||..   :|.||         |:.:.|..||           .:.
Mouse   253 SVQCGDTFSPALSHAESAQTCTGKKSYECKECGKSFKYSANLNIHMRTHTGEKPYQCKECGKAFS 317

  Fly   204 QTAPLI---------SPAASSV------SSS---------TGSIRP--VRDLIMSATGGAASTNI 242
            :..||.         .|....|      :||         || |:|  .:|...:.||   .:.:
Mouse   318 RCYPLTQHLKTHTEEKPFECKVCGKCFRNSSCLNDHFRVHTG-IKPYKCKDCGKAFTG---RSGL 378

  Fly   243 SLTTVTNLSLNSVQATAVGMMPKMTGGLIT-----------------TAVGSNSGAIGGIGGYNA 290
            |....|:......:....|.....|.|||.                 .|..|:|..|..:    .
Mouse   379 SKHLPTHTGEKPYECKECGKAFPSTSGLIKHMKSHMGERPFECDHCGKAFASSSTLITHL----R 439

  Fly   291 TSAEEISYKCRICEKVFGCSETLQAHEKTHKSPR-YECADCGKGFSQLRNYKYHLSVHRGTKEFA 354
            |...|..::|::|.|.|.||..|:.|.:||...: |.|.:||:.|::..:...||..|.|...| 
Mouse   440 THTGEKPFECQVCGKAFTCSSYLRIHMRTHTGEKPYVCKECGRAFTERTSLTKHLRTHTGENPF- 503

  Fly   355 AECPECGKTFNDKGYLSSHLKIHRNRKEYECPYCPKSFNQRVAFNMHVRIHTGVKPHKCNECGKR 419
             ||..|||.|....||.:|::.|...|.|.|..|.|:|......:.|||||||.|||||.||||.
Mouse   504 -ECNMCGKAFACSSYLHNHIRTHTGEKPYVCKECGKAFTVSSHLSKHVRIHTGEKPHKCEECGKA 567

  Fly   420 FSRKMLLKQHMRTHSGEKPYQCSVCGKSFADRSNMTLHHRLHSGIKPFSCPLCPKAFTKKHHLKT 484
            |:.:..|.:|:|||:|||||.|..|||:|...|.:..|.|.|:|.||:.|..|.|||....:|..
Mouse   568 FTVRSGLTKHIRTHTGEKPYNCKECGKAFTTSSGLLEHKRSHTGEKPYECDQCGKAFASSSYLIA 632

  Fly   485 HLNYHTGCKPYVCPHPNCNQAFTQSS----NMRTH-------AKKC 519
            ||..|||.||:.|  ..|.:|||.||    :||||       .|:|
Mouse   633 HLRIHTGEKPFEC--NECGKAFTCSSYLHIHMRTHTGEKPYDCKEC 676

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15269NP_609739.2 C2H2 Zn finger 300..320 CDD:275368 8/19 (42%)
COG5048 <316..502 CDD:227381 82/186 (44%)
C2H2 Zn finger 327..347 CDD:275368 6/19 (32%)
zf-C2H2 356..377 CDD:278523 9/20 (45%)
C2H2 Zn finger 357..377 CDD:275368 8/19 (42%)
zf-H2C2_2 369..394 CDD:290200 10/24 (42%)
C2H2 Zn finger 385..405 CDD:275368 7/19 (37%)
zf-H2C2_2 397..422 CDD:290200 17/24 (71%)
C2H2 Zn finger 413..433 CDD:275368 9/19 (47%)
zf-H2C2_2 426..449 CDD:290200 14/22 (64%)
zf-C2H2 439..461 CDD:278523 9/21 (43%)
C2H2 Zn finger 441..461 CDD:275368 8/19 (42%)
zf-C2H2 467..489 CDD:278523 8/21 (38%)
C2H2 Zn finger 469..489 CDD:275368 8/19 (42%)
C2H2 Zn finger 497..515 CDD:275368 9/21 (43%)
Zfp560NP_001004190.2 KRAB 41..97 CDD:214630
KRAB 41..80 CDD:279668
COG5048 276..689 CDD:227381 134/413 (32%)
zf-C2H2 279..301 CDD:278523 5/21 (24%)
C2H2 Zn finger 281..301 CDD:275368 5/19 (26%)
zf-H2C2_2 293..318 CDD:290200 4/24 (17%)
C2H2 Zn finger 309..329 CDD:275368 2/19 (11%)
zf-H2C2_2 322..346 CDD:290200 3/23 (13%)
C2H2 Zn finger 337..357 CDD:275368 3/19 (16%)
zf-H2C2_2 350..373 CDD:290200 5/23 (22%)
C2H2 Zn finger 365..385 CDD:275368 4/22 (18%)
C2H2 Zn finger 393..413 CDD:275368 5/19 (26%)
zf-H2C2_2 406..430 CDD:290200 3/23 (13%)
C2H2 Zn finger 421..441 CDD:275368 4/23 (17%)
zf-H2C2_2 434..458 CDD:290200 7/27 (26%)
C2H2 Zn finger 449..469 CDD:275368 8/19 (42%)
zf-H2C2_2 461..485 CDD:290200 8/23 (35%)
C2H2 Zn finger 477..497 CDD:275368 6/19 (32%)
zf-H2C2_2 489..514 CDD:290200 11/26 (42%)
C2H2 Zn finger 505..525 CDD:275368 8/19 (42%)
zf-H2C2_2 520..541 CDD:290200 7/20 (35%)
C2H2 Zn finger 533..553 CDD:275368 7/19 (37%)
zf-H2C2_2 545..569 CDD:290200 16/23 (70%)
C2H2 Zn finger 561..581 CDD:275368 9/19 (47%)
zf-H2C2_2 574..598 CDD:290200 15/23 (65%)
C2H2 Zn finger 589..609 CDD:275368 8/19 (42%)
zf-H2C2_2 602..626 CDD:290200 11/23 (48%)
C2H2 Zn finger 617..637 CDD:275368 8/19 (42%)
zf-H2C2_2 629..654 CDD:290200 12/26 (46%)
C2H2 Zn finger 645..665 CDD:275368 9/21 (43%)
zf-H2C2_2 661..681 CDD:290200 6/16 (38%)
C2H2 Zn finger 673..693 CDD:275368 2/4 (50%)
C2H2 Zn finger 701..718 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.