Sequence 1: | NP_609739.2 | Gene: | CG15269 / 34887 | FlyBaseID: | FBgn0028878 | Length: | 587 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_732827.1 | Gene: | CG31365 / 42736 | FlyBaseID: | FBgn0051365 | Length: | 639 | Species: | Drosophila melanogaster |
Alignment Length: | 196 | Identity: | 60/196 - (30%) |
---|---|---|---|
Similarity: | 91/196 - (46%) | Gaps: | 34/196 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 297 SYKCRICEKVFGCSETLQAHEKTH----KSPRYECADCGKGFSQLRNYKYHLSVHRGTKEFAAEC 357
Fly 358 PECGKTFNDKGYLSSHLKIHRNRKEYECPYCPKSFNQRVAFNMHVRIHTGVKPHKCNECGKRFSR 422
Fly 423 KMLLKQHM-RTHSG-EKPYQCSVCGKSFADRSNMTLHHRLHSGIKPFSCPLCPKAFTKKHHLKTH 485
Fly 486 L 486 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG15269 | NP_609739.2 | C2H2 Zn finger | 300..320 | CDD:275368 | 5/19 (26%) |
COG5048 | <316..502 | CDD:227381 | 55/177 (31%) | ||
C2H2 Zn finger | 327..347 | CDD:275368 | 3/19 (16%) | ||
zf-C2H2 | 356..377 | CDD:278523 | 5/20 (25%) | ||
C2H2 Zn finger | 357..377 | CDD:275368 | 5/19 (26%) | ||
zf-H2C2_2 | 369..394 | CDD:290200 | 9/24 (38%) | ||
C2H2 Zn finger | 385..405 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 397..422 | CDD:290200 | 10/24 (42%) | ||
C2H2 Zn finger | 413..433 | CDD:275368 | 8/20 (40%) | ||
zf-H2C2_2 | 426..449 | CDD:290200 | 9/24 (38%) | ||
zf-C2H2 | 439..461 | CDD:278523 | 6/21 (29%) | ||
C2H2 Zn finger | 441..461 | CDD:275368 | 6/19 (32%) | ||
zf-C2H2 | 467..489 | CDD:278523 | 6/20 (30%) | ||
C2H2 Zn finger | 469..489 | CDD:275368 | 4/18 (22%) | ||
C2H2 Zn finger | 497..515 | CDD:275368 | |||
CG31365 | NP_732827.1 | zf-AD | 13..86 | CDD:214871 | |
vATP-synt_E | 109..>244 | CDD:304907 | |||
RRF | <161..222 | CDD:294170 | |||
zf-C2H2_8 | 454..530 | CDD:292531 | 27/102 (26%) | ||
C2H2 Zn finger | 485..505 | CDD:275368 | 5/19 (26%) | ||
zf-H2C2_2 | 497..522 | CDD:290200 | 9/24 (38%) | ||
C2H2 Zn finger | 513..533 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 526..550 | CDD:290200 | 10/23 (43%) | ||
C2H2 Zn finger | 541..562 | CDD:275368 | 8/20 (40%) | ||
C2H2 Zn finger | 571..591 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 598..617 | CDD:275368 | 4/18 (22%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |