DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15269 and CG31365

DIOPT Version :9

Sequence 1:NP_609739.2 Gene:CG15269 / 34887 FlyBaseID:FBgn0028878 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_732827.1 Gene:CG31365 / 42736 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster


Alignment Length:196 Identity:60/196 - (30%)
Similarity:91/196 - (46%) Gaps:34/196 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   297 SYKCRICEKVFGCSETLQAHEKTH----KSPRYECADCGKGFSQLRNYKYHLSVHRGTKEFAAEC 357
            |::|.:|...|...:.|..|..||    ||        |||               ||    .:|
  Fly   448 SFQCHLCPVAFPTQKLLTRHHNTHIKGLKS--------GKG---------------GT----LKC 485

  Fly   358 PECGKTFNDKGYLSSHLKIHRNRKEYECPYCPKSFNQRVAFNMHVRIHTGVKPHKCNECGKRFSR 422
            |.|....:....|..|:.||...|.::|..|..||:||.....|:..|||||.|:|.:|...|::
  Fly   486 PSCALQLSCASSLKRHMIIHTGLKPFKCSECELSFSQREVLKRHMDTHTGVKRHQCPQCSSCFAQ 550

  Fly   423 KMLLKQHM-RTHSG-EKPYQCSVCGKSFADRSNMTLHHRLHSGIKPFSCPLCPKAFTKKHHLKTH 485
            |..|:||: |.|.| .:.::|.:|.:||...|.::.|...|:|:. |||..|.:.|..:..::.|
  Fly   551 KSNLQQHIGRVHMGNSRTHKCHLCHRSFNHVSGLSRHLVTHAGVM-FSCKQCGRQFNDRSAVQRH 614

  Fly   486 L 486
            :
  Fly   615 V 615

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15269NP_609739.2 C2H2 Zn finger 300..320 CDD:275368 5/19 (26%)
COG5048 <316..502 CDD:227381 55/177 (31%)
C2H2 Zn finger 327..347 CDD:275368 3/19 (16%)
zf-C2H2 356..377 CDD:278523 5/20 (25%)
C2H2 Zn finger 357..377 CDD:275368 5/19 (26%)
zf-H2C2_2 369..394 CDD:290200 9/24 (38%)
C2H2 Zn finger 385..405 CDD:275368 7/19 (37%)
zf-H2C2_2 397..422 CDD:290200 10/24 (42%)
C2H2 Zn finger 413..433 CDD:275368 8/20 (40%)
zf-H2C2_2 426..449 CDD:290200 9/24 (38%)
zf-C2H2 439..461 CDD:278523 6/21 (29%)
C2H2 Zn finger 441..461 CDD:275368 6/19 (32%)
zf-C2H2 467..489 CDD:278523 6/20 (30%)
C2H2 Zn finger 469..489 CDD:275368 4/18 (22%)
C2H2 Zn finger 497..515 CDD:275368
CG31365NP_732827.1 zf-AD 13..86 CDD:214871
vATP-synt_E 109..>244 CDD:304907
RRF <161..222 CDD:294170
zf-C2H2_8 454..530 CDD:292531 27/102 (26%)
C2H2 Zn finger 485..505 CDD:275368 5/19 (26%)
zf-H2C2_2 497..522 CDD:290200 9/24 (38%)
C2H2 Zn finger 513..533 CDD:275368 7/19 (37%)
zf-H2C2_2 526..550 CDD:290200 10/23 (43%)
C2H2 Zn finger 541..562 CDD:275368 8/20 (40%)
C2H2 Zn finger 571..591 CDD:275368 6/19 (32%)
C2H2 Zn finger 598..617 CDD:275368 4/18 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.