DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15269 and lmd

DIOPT Version :9

Sequence 1:NP_609739.2 Gene:CG15269 / 34887 FlyBaseID:FBgn0028878 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_732811.1 Gene:lmd / 42717 FlyBaseID:FBgn0039039 Length:866 Species:Drosophila melanogaster


Alignment Length:744 Identity:166/744 - (22%)
Similarity:238/744 - (31%) Gaps:267/744 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 SPARTSPTNGVQNLGAGAQLPPAQVTDFS-ISKILGKERKS------AQDTSTNILDLSKSSSNS 68
            |..:||.:.|:.          .:.:..| ||.|.|||..|      :...|.||     :::|.
  Fly     3 SSLKTSQSGGMY----------VKTSSISGISSISGKEAASCYGGFMSPPLSANI-----TANNG 52

  Fly    69 IRSPQALGGLAIPST-PYASGAYSMLPPDLVAMANATKFYAQFFPHLLPA-------------YA 119
            .|....:.|..:.:. .||.|....  ||              |.||..|             ||
  Fly    53 EREMFRVPGAKVETNESYACGELQF--PD--------------FSHLCFAAETPNSVFSDCHNYA 101

  Fly   120 ---------------AAAAAAGLSTPPTSPYQTHQHQQHLPNQQKRF-FAPYVI---NGSVPPPP 165
                           |||...|:      |||..|:.|  .|::..| |.|..|   .|....|.
  Fly   102 GQDQQQDSDQDDIVCAAAENTGM------PYQQGQYTQ--LNREDIFRFEPEDIARLTGESELPG 158

  Fly   166 PLQQQQQPLI----RTKSTACTRPDCPEC-----------LDY--YQRLQTGGYKQTAPLISPAA 213
            .||..|.|..    .|..|.|:..:....           :||  |..:.... |..:|..||..
  Fly   159 MLQHPQTPYTPYTPYTPYTPCSAQNSQYAVQPANDSINLDIDYFNYDEINCQS-KNQSPCSSPHL 222

  Fly   214 SS-VSSSTGSIRPVRDLIMSATGGAASTNISLTTVTNLSLNSVQATA-VGMMPKMTGGLIT---- 272
            .: ::.:.|.|           ..|||::.:...:.|:....|:..| ...:|.|.....|    
  Fly   223 DAWLNFNLGEI-----------SAAASSSAASPKLGNVFEEQVKEEASPAKLPSMNSTFGTPKCI 276

  Fly   273 TAVGSN---------SGAIGGIGGYNATSAEEISYKCRICEKVFGCSET-----------LQAH- 316
            ....||         .|:......|:...|:.:....|..:.::...|.           ||.| 
  Fly   277 PMCASNYEDYANLYQQGSGYSTENYHNNMAQVVEKPNREHKAIWTIDELDELMLGEQQQFLQHHL 341

  Fly   317 ---------EKTHKSPRYECADCGKGFSQLRNYKYHLSVHRGTKEFAAE---------------- 356
                     |:.|:....|        .|.:|.|..|..:...:...||                
  Fly   342 QQQHLQEQQEQLHQPHGQE--------QQTQNCKDDLVNYLSDEFIKAEEFRSLDSDDDENYNEE 398

  Fly   357 -----------------------C-----PE------------CGKTFNDKGYLSSHL-KIH--- 377
                                   |     ||            |.:.|..:.....|: |.|   
  Fly   399 EDDLDNDVFAPPAESDPKPDSTCCDPEAEPENEVIPLICRWTGCDEEFPHQQAFVEHIEKCHVDV 463

  Fly   378 RNRKEYECPY--CP---KSFNQRVAFNMHVRIHTGVKPHKC--NECGKRFSRKMLLKQHMRTHSG 435
            |..:::.|.:  ||   |.||.|....:|:|:|:|.||:||  ..|.|.|||...||.|.|:|:|
  Fly   464 RKGEDFSCFWLDCPRRYKPFNARYKLLIHMRVHSGEKPNKCPFPGCNKAFSRLENLKIHQRSHTG 528

  Fly   436 EKPYQCSV--CGKSFADRSNMTLHHRLHSGIKPFSCPLCPKAFTKKHHLKTHLNYHTGCKPYVCP 498
            |:||.|..  |.|:|::.|:...|.|.|                          |.|  |||.|.
  Fly   529 ERPYGCQYKGCLKAFSNSSDRAKHQRTH--------------------------YDT--KPYACQ 565

  Fly   499 HPNCNQAFTQSSNMRTHAKKCQYRPLDGLTVTSSA----LPVPGKQQTGPPPTLAMAMAQTFQMP 559
            .|.|.:.:|..|::|.|.|....|..:|.....||    :|..|      |...|.....:....
  Fly   566 LPGCTKRYTDPSSLRKHVKNHALRNANGQLRRKSAGGASVPPSG------PKKAAKTRRHSESAL 624

  Fly   560 PPPGVLTPGSG-----PSQPPSQQTLLSN 583
            ...||   |:|     ||.|..|:...||
  Fly   625 VQRGV---GAGVGVAVPSAPGDQRQHRSN 650

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15269NP_609739.2 C2H2 Zn finger 300..320 CDD:275368 6/40 (15%)
COG5048 <316..502 CDD:227381 63/264 (24%)
C2H2 Zn finger 327..347 CDD:275368 4/19 (21%)
zf-C2H2 356..377 CDD:278523 8/77 (10%)
C2H2 Zn finger 357..377 CDD:275368 7/37 (19%)
zf-H2C2_2 369..394 CDD:290200 9/33 (27%)
C2H2 Zn finger 385..405 CDD:275368 9/24 (38%)
zf-H2C2_2 397..422 CDD:290200 11/26 (42%)
C2H2 Zn finger 413..433 CDD:275368 10/21 (48%)
zf-H2C2_2 426..449 CDD:290200 12/24 (50%)
zf-C2H2 439..461 CDD:278523 8/23 (35%)
C2H2 Zn finger 441..461 CDD:275368 7/21 (33%)
zf-C2H2 467..489 CDD:278523 0/21 (0%)
C2H2 Zn finger 469..489 CDD:275368 0/19 (0%)
C2H2 Zn finger 497..515 CDD:275368 6/17 (35%)
lmdNP_732811.1 zf-H2C2_2 489..515 CDD:290200 11/25 (44%)
C2H2 Zn finger 504..526 CDD:275368 10/21 (48%)
C2H2 Zn finger 534..556 CDD:275368 7/21 (33%)
C2H2 Zn finger 564..586 CDD:275368 8/21 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.