DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15269 and CG17801

DIOPT Version :9

Sequence 1:NP_609739.2 Gene:CG15269 / 34887 FlyBaseID:FBgn0028878 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_650660.2 Gene:CG17801 / 42144 FlyBaseID:FBgn0038550 Length:381 Species:Drosophila melanogaster


Alignment Length:133 Identity:45/133 - (33%)
Similarity:66/133 - (49%) Gaps:2/133 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   357 CPECGKTFNDKGYLSSHLKIHRNRKEYECPYCPKSFNQRVAFNMHVRI-HTGVKPHKCNECGKRF 420
            ||:||:.|.....|.:|:..|...|.:.|.:|.|.|..:....:|.|: |.|.:|.:||.|...|
  Fly   232 CPKCGRVFKTPYNLKTHMVRHTGEKNFPCTFCDKRFVTKYLARLHERVRHMGEQPFECNFCSATF 296

  Fly   421 SRKMLLKQHMR-THSGEKPYQCSVCGKSFADRSNMTLHHRLHSGIKPFSCPLCPKAFTKKHHLKT 484
            ........|.| .|..:..|||..|.|.|..::.:..|..||||:|||.|.:|...|.:|..|::
  Fly   297 FTSTAKSSHERIRHIRDLRYQCDQCTKRFNTKTCLNKHKFLHSGLKPFDCVICQINFARKATLRS 361

  Fly   485 HLN 487
            |.:
  Fly   362 HFD 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15269NP_609739.2 C2H2 Zn finger 300..320 CDD:275368
COG5048 <316..502 CDD:227381 45/133 (34%)
C2H2 Zn finger 327..347 CDD:275368
zf-C2H2 356..377 CDD:278523 7/19 (37%)
C2H2 Zn finger 357..377 CDD:275368 7/19 (37%)
zf-H2C2_2 369..394 CDD:290200 8/24 (33%)
C2H2 Zn finger 385..405 CDD:275368 6/20 (30%)
zf-H2C2_2 397..422 CDD:290200 9/25 (36%)
C2H2 Zn finger 413..433 CDD:275368 6/20 (30%)
zf-H2C2_2 426..449 CDD:290200 8/23 (35%)
zf-C2H2 439..461 CDD:278523 7/21 (33%)
C2H2 Zn finger 441..461 CDD:275368 5/19 (26%)
zf-C2H2 467..489 CDD:278523 7/21 (33%)
C2H2 Zn finger 469..489 CDD:275368 6/19 (32%)
C2H2 Zn finger 497..515 CDD:275368
CG17801NP_650660.2 zf-AD 9..74 CDD:285071
zf-C2H2 231..252 CDD:278523 7/19 (37%)
C2H2 Zn finger 232..252 CDD:275368 7/19 (37%)
zf-H2C2_2 244..269 CDD:290200 8/24 (33%)
C2H2 Zn finger 260..281 CDD:275368 6/20 (30%)
C2H2 Zn finger 289..308 CDD:275368 5/18 (28%)
C2H2 Zn finger 318..338 CDD:275368 5/19 (26%)
C2H2 Zn finger 346..362 CDD:275368 5/15 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457848
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.