| Sequence 1: | NP_609739.2 | Gene: | CG15269 / 34887 | FlyBaseID: | FBgn0028878 | Length: | 587 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_649823.2 | Gene: | CG8159 / 41040 | FlyBaseID: | FBgn0037619 | Length: | 399 | Species: | Drosophila melanogaster |
| Alignment Length: | 234 | Identity: | 60/234 - (25%) |
|---|---|---|---|
| Similarity: | 103/234 - (44%) | Gaps: | 33/234 - (14%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 323 PRYECADCGKGFSQLRNYKYHLSVHRGTKEFAAECPECGKTFNDKGYLSSHLKIHRNRKEYECPY 387
Fly 388 CPKSFNQRVAFNMHVRIHTGVKPHKCNECGKRFSRKMLLKQHMRTHSGEKPYQCSVCGKSFADRS 452
Fly 453 NMTLHHRLHSGIKPFSCPLCPKAFTKKHHLKTHLNYHTGCKPYVCPHPNCNQA-FTQSSNMRTHA 516
Fly 517 KKCQYRPLDGLTVTSSALPVPGKQQTGPPPTLAMAMAQT 555 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG15269 | NP_609739.2 | C2H2 Zn finger | 300..320 | CDD:275368 | |
| COG5048 | <316..502 | CDD:227381 | 49/178 (28%) | ||
| C2H2 Zn finger | 327..347 | CDD:275368 | 5/19 (26%) | ||
| zf-C2H2 | 356..377 | CDD:278523 | 6/20 (30%) | ||
| C2H2 Zn finger | 357..377 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 369..394 | CDD:290200 | 6/24 (25%) | ||
| C2H2 Zn finger | 385..405 | CDD:275368 | 5/19 (26%) | ||
| zf-H2C2_2 | 397..422 | CDD:290200 | 10/24 (42%) | ||
| C2H2 Zn finger | 413..433 | CDD:275368 | 9/19 (47%) | ||
| zf-H2C2_2 | 426..449 | CDD:290200 | 10/22 (45%) | ||
| zf-C2H2 | 439..461 | CDD:278523 | 7/21 (33%) | ||
| C2H2 Zn finger | 441..461 | CDD:275368 | 7/19 (37%) | ||
| zf-C2H2 | 467..489 | CDD:278523 | 4/21 (19%) | ||
| C2H2 Zn finger | 469..489 | CDD:275368 | 4/19 (21%) | ||
| C2H2 Zn finger | 497..515 | CDD:275368 | 3/18 (17%) | ||
| CG8159 | NP_649823.2 | zf-AD | 5..78 | CDD:214871 | |
| C2H2 Zn finger | 194..214 | CDD:275368 | 5/19 (26%) | ||
| COG5048 | <197..322 | CDD:227381 | 39/126 (31%) | ||
| zf-H2C2_2 | 206..231 | CDD:290200 | 8/26 (31%) | ||
| C2H2 Zn finger | 222..242 | CDD:275368 | 6/19 (32%) | ||
| C2H2 Zn finger | 250..270 | CDD:275368 | 5/19 (26%) | ||
| zf-H2C2_2 | 265..287 | CDD:290200 | 10/21 (48%) | ||
| C2H2 Zn finger | 278..298 | CDD:275368 | 9/19 (47%) | ||
| zf-H2C2_2 | 291..315 | CDD:290200 | 11/23 (48%) | ||
| C2H2 Zn finger | 306..328 | CDD:275368 | 7/36 (19%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||